anti-Human Cysteine-serine-Rich Nuclear Protein 1 antibody for Western Blotting

Recommended Cysteine-serine-Rich Nuclear Protein 1 Antibody (supplied by: Log in to see )

Antigen
Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) Antibodies
  • AXUD1
  • CSRNP-1
  • FAM130B
  • TAIP-3
  • URAX1
  • 4931429D10Rik
  • Axud1
  • taip-3
  • CSRNP1
  • axud1
  • MGC145297
  • fb73e11
  • wu:fb73e11
  • zgc:66340
  • cysteine and serine rich nuclear protein 1
  • cysteine-serine-rich nuclear protein 1
  • cysteine-serine-rich nuclear protein 1 L homeolog
  • cysteine-serine-rich nuclear protein 1b
  • CSRNP1
  • Csrnp1
  • csrnp1
  • csrnp1.L
  • csrnp1b
Epitope
Middle Region
2
2
2
2
1
1
Reactivity
Human
46
23
23
2
2
2
1
1
1
1
Host
Rabbit
39
7
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
29
13
12
10
7
5
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN631806
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.028116 ABIN636279 WB Rabbit IgG Log in to see Polyclonal 0
12.028116 ABIN6139132 IF IHC WB Rabbit Log in to see Polyclonal 0
10 ABIN2970492 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
10 ABIN2562045 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
7.7269974 ABIN566269 ELISA WB Mouse AA 1-589 Log in to see Polyclonal 0
4.7269974 ABIN2787343 WB Rabbit Middle Region Log in to see Polyclonal 0
4.7269974 ABIN5536849 WB Rabbit Ig Fraction AA 501-533 Log in to see Polyclonal 0
4 ABIN575462 WB Rabbit AA 287-336 Log in to see Polyclonal 0
4 ABIN566270 ELISA WB Mouse IgG2a kappa AA 1-589 Log in to see 5E8 0
4 ABIN6718609 IF IHC WB Rabbit Log in to see Polyclonal 0
1 ABIN884296 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN2882991 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN884305 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN873046 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN205206 ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2596954 ELISA WB Mouse IgG2a, kappa AA 1-590 Log in to see 0
1 ABIN3072937 WB Mouse IgG1 Log in to see 8C27 0
1 ABIN2207407 ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2207410 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2207412 WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) Antibodies
Epitope Middle Region
(2), (2), (2), (2), (1), (1)
Reactivity Human
(46), (23), (23), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(39), (7)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(29), (13), (12), (10), (7), (5), (2), (2), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity AXUD1 antibody was raised against the middle region of AXUD1
Purification Affinity purified
Immunogen AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name AXUD1 (CSRNP1 Antibody Abstract)
Background This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.
Molecular Weight 63 kDa (MW of target protein)
Pathways Platelet-derived growth Factor Receptor Signaling

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

AXUD1 Blocking Peptide, catalog no. 33R-1498, is also available for use as a blocking control in assays to test for specificity of this AXUD1 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AXUD1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) (Middle Region) antibody (ABIN631806) AXUD1 antibody used at 1 ug/ml to detect target protein.