anti-Human PLA2R1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PLA2R1 Antibody (supplied by: Log in to see )

Antigen
phospholipase A2 Receptor 1, 180kDa (PLA2R1) Antibodies
  • Pla2-r
  • Pla2g1br
  • Pla2r
  • CLEC13C
  • PLA2-R
  • PLA2G1R
  • PLA2IR
  • PLA2R
  • phospholipase A2 receptor 1
  • PLA2R1
  • Pla2r1
Reactivity
Human
72
5
3
2
1
1
1
Host
Rabbit
31
27
16
Clonality
Polyclonal
Conjugate
This PLA2R1 antibody is un-conjugated
6
5
4
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
59
45
31
17
9
9
5
4
3
3
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4345962
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.320707 ABIN4963108 IHC IHC (p) WB Mouse IgG1 Log in to see CL0474 0
10 ABIN5650146 IF IHC (p) WB Mouse IgG1 Log in to see CL0474 0
7 ABIN5650147 IHC (p) WB Mouse IgG1 Log in to see CL0485 0
4 ABIN5585766 IHC (p) Rabbit IgG Log in to see Polyclonal 0
-9.407196 ABIN4963109 IHC IHC (p) WB Mouse IgG1 Log in to see CL0485 0

General

Antigen phospholipase A2 Receptor 1, 180kDa (PLA2R1) Antibodies
Reactivity Human
(72), (5), (3), (2), (1), (1), (1)
Host Rabbit
(31), (27), (16)
Clonality
Polyclonal
Conjugate This PLA2R1 antibody is un-conjugated
(6), (5), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(59), (45), (31), (17), (9), (9), (5), (4), (3), (3), (1), (1)
Pubmed 8 references available
Supplier Log in to see

Product Details anti-PLA2R1 Antibody

Target Details PLA2R1 Application Details Handling References for anti-PLA2R1 antibody (ABIN4345962) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Isotype IgG
Plasmids, Primers & others

Target Details PLA2R1

Product Details anti-PLA2R1 Antibody Application Details Handling References for anti-PLA2R1 antibody (ABIN4345962) Images back to top
Antigen
Alternative Name PLA2R1 (PLA2R1 Antibody Abstract)
Background Gene Symbol: PLA2R1
Gene ID 22925
UniProt Q13018
Pathways Positive Regulation of Response to DNA Damage Stimulus

Application Details

Product Details anti-PLA2R1 Antibody Target Details PLA2R1 Handling References for anti-PLA2R1 antibody (ABIN4345962) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry 1:500-1:1000, Immunohistochemistry-Paraffin 1:500-1:1000Immunohistochemistry retrieval method recommended:HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PLA2R1 Antibody Target Details PLA2R1 Application Details References for anti-PLA2R1 antibody (ABIN4345962) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PLA2R1 antibody (ABIN4345962)

Product Details anti-PLA2R1 Antibody Target Details PLA2R1 Application Details Handling Images back to top
Product cited in:

Akiyama, Akiyama, Imai, Ozaki, Matsuo, Maruyama: "Prevalence of anti-phospholipase A2 receptor antibodies in Japanese patients with membranous nephropathy." in: Clinical and experimental nephrology, Vol. 19, Issue 4, pp. 653-60, 2015 (Sample species: Human). Further details: Western Blotting

Dauvergne, Moktefi, Rabant, Vigneau, Kofman, Burtey, Corpechot, Stehlé, Desvaux, Rioux-Leclercq, Rouvier, Knebelmann, Boffa, Frouget, Daugas, Jablonski, Dahan, Brocheriou, Remy, Grimbert, Lang et al.: "Membranous Nephropathy Associated With Immunological Disorder-Related Liver Disease: A Retrospective Study of 10 Cases. ..." in: Medicine, Vol. 94, Issue 30, pp. e1243, 2015 (Sample species: Human). Further details: Immunohistochemistry

Iwakura, Ohashi, Kato, Baba, Yasuda: "Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy." in: PLoS ONE, Vol. 10, Issue 9, pp. e0138841, 2015 (Sample species: Human). Further details: Immunohistochemistry

Svobodova, Honsova, Ronco, Tesar, Debiec: "Kidney biopsy is a sensitive tool for retrospective diagnosis of PLA2R-related membranous nephropathy." in: Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association, Vol. 28, Issue 7, pp. 1839-44, 2013

Augert, Vindrieux, Girard, Le Calvé, Gras, Ferrand, Bouchet, Puisieux, de Launoit, Simonnet, Lambeau, Bernard: "PLA2R1 kills cancer cells by inducing mitochondrial stress." in: Free radical biology & medicine, Vol. 65, pp. 969-77, 2013

Hoxha, Kneißler, Stege, Zahner, Thiele, Panzer, Harendza, Helmchen, Stahl: "Enhanced expression of the M-type phospholipase A2 receptor in glomeruli correlates with serum receptor antibodies in primary membranous nephropathy." in: Kidney international, Vol. 82, Issue 7, pp. 797-804, 2012

Debiec, Ronco: "PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy." in: The New England journal of medicine, Vol. 364, Issue 7, pp. 689-90, 2011

Debiec, Martin, Jouanneau, Dautin, Mesnard, Rondeau, Mousson, Ronco: "Autoantibodies specific for the phospholipase A2 receptor in recurrent and De Novo membranous nephropathy." in: American journal of transplantation : official journal of the American Society of Transplantation and the American Society of Transplant Surgeons, Vol. 11, Issue 10, pp. 2144-52, 2011

Images

Product Details anti-PLA2R1 Antibody Target Details PLA2R1 Application Details Handling References for anti-PLA2R1 antibody (ABIN4345962) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phospholipase A2 Receptor 1, 180kDa (PLA2R1) antibody (ABIN4345962) Immunohistochemistry-Paraffin: PLA2R1 Antibody [NBP1-84449] - Staining of human lymph...
Immunofluorescence (IF) image for anti-phospholipase A2 Receptor 1, 180kDa (PLA2R1) antibody (ABIN4345962) Immunocytochemistry/Immunofluorescence: PLA2R1 Antibody [NBP1-84449] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phospholipase A2 Receptor 1, 180kDa (PLA2R1) antibody (ABIN4345962) Immunohistochemistry-Paraffin: PLA2R1 Antibody - Staining of human kidney shows weak...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phospholipase A2 Receptor 1, 180kDa (PLA2R1) antibody (ABIN4345962) Immunohistochemistry-Paraffin: PLA2R1 Antibody - Staining in human kidney and pancre...
Western Blotting (WB) image for anti-phospholipase A2 Receptor 1, 180kDa (PLA2R1) antibody (ABIN4345962) Western Blot: PLA2R1 Antibody - Analysis in human kidney tissue.