Thioredoxin Reductase Protein (TrxR) (AA 1-334) (His tag)
-
- Target See all Thioredoxin Reductase (TrxR) Proteins
- Thioredoxin Reductase (TrxR)
- Protein Type
- Recombinant
- Protein Characteristics
- AA 1-334
-
Origin
- Neurospora crassa
-
Source
- Yeast
- Purification tag / Conjugate
- This Thioredoxin Reductase protein is labelled with His tag.
- Application
- ELISA
- Sequence
- MHSKVVIIGSGPAAHTAAIYLARAELKPVLYEGFMANGIA PAEHRDTSAVQGNL
- Specificity
- Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
- Purity
- > 90 %
- Top Product
- Discover our top product TrxR Protein
-
-
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Buffer
- PBS pH 7.4, 50% glycerol
- Handling Advice
- Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
- Storage
- -20 °C
- Storage Comment
- Store at -20 °C, for extended storage, conserve at -20 °C or -80 °C.
-
- Target
- Thioredoxin Reductase (TrxR)
- Abstract
- TrxR Products
- Synonyms
- Prx V Protein, peroxiredoxin 5 Protein, thioredoxin reductase Protein, thioredoxin-disulfide reductase Protein, PRDX5 Protein, trxR Protein, SACI_RS04445 Protein
- Background
- Thioredoxin reductase. EC= 1.8.1.9
- UniProt
- P51978
-