Endomucin Protein (EMCN) (Monomer, Soluble) (His tag)
-
- Target See all Endomucin (EMCN) Proteins
- Endomucin (EMCN)
- Protein Type
- Recombinant
- Protein Characteristics
- Monomer, Soluble
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This Endomucin protein is labelled with His tag.
- Sequence
- MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVV TTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMS LMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLP NAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGT LTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
- Characteristics
-
Length (AA): 197
Chromosomal location: 4q24 - Purity
- > 95 % by SDS-PAGE. Visualized by silver stain
- Top Product
- Discover our top product EMCN Protein
-
-
- Application Notes
- No biological data available at the moment.
- Comment
-
Soluble Receptors
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers, it should be reconstituted in water or PBS to a concentration of not lower than 100 μg/mL.
- Buffer
- 10 mM NaP, pH 7.0
- Storage
- -20 °C/-80 °C
- Storage Comment
- The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.
- Expiry Date
- 6 months
-
- Target
- Endomucin (EMCN)
- Alternative Name
- Endomucin (EMCN Products)
- Synonyms
- EMCN2 Protein, MUC14 Protein, 0610012K22Rik Protein, AI315669 Protein, Muc14 Protein, endomucin Protein, EMCN Protein, Emcn Protein
- Background
-
Endomucin (endothelial sialomucin, also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60 % and 30 % aa identity with rat and human Endomucin, respectively.
Synonyms: Endomucin-2, Gastric cancer antigen Ga34, Mucin-14 - Molecular Weight
- 20.4 kDa
- NCBI Accession
- NP_001153166, NM_001159694
- UniProt
- Q9ULC0
-