PDCD10 Protein (His tag)
-
- Target See all PDCD10 Proteins
- PDCD10 (Programmed Cell Death 10 (PDCD10))
- Protein Type
- Recombinant
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This PDCD10 protein is labelled with His tag.
- Sequence
- MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMP LYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQD IIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ DLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKEL LDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTY FKDGKAINVFVSANRLIHQTNLILQTFKTVA
- Characteristics
-
Length (AA): 231
Chromosomal location: 3q26.1 - Purity
- > 95 % by SDS-PAGE. Visualized by silver stain
- Top Product
- Discover our top product PDCD10 Protein
-
-
- Application Notes
- Not determined yet.
- Comment
-
Cytokines & Growth Factors
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- The lyophilized CCM3 is soluble in water and most aqueous buffers and should be reconstituted in water or PBS.
- Buffer
- PBS
- Storage
- -20 °C/-80 °C
- Storage Comment
- Lyophilized samples are stable for greater than six months at -20 °C to -70 °C. Reconstituted CCM-3 should be stored in working aliquots at -20 °C.
- Expiry Date
- 6 months
-
- Target
- PDCD10 (Programmed Cell Death 10 (PDCD10))
- Alternative Name
- CCM-3 (PDCD10 Products)
- Synonyms
- CCM3 Protein, TFAR15 Protein, 2410003B13Rik Protein, Ccm3 Protein, Tfa15 Protein, Tfar15 Protein, zgc:85629 Protein, ccm3a Protein, pdcd10 Protein, zgc:65826 Protein, programmed cell death 10 Protein, programmed cell death 10 S homeolog Protein, programmed cell death 10b Protein, programmed cell death 10a Protein, PDCD10 Protein, Pdcd10 Protein, pdcd10.S Protein, pdcd10b Protein, pdcd10a Protein
- Background
-
Cerebral cavernous malformations (CCMs) are sporadically acquired or inherited vascular lesions of the central nervous system consisting of clusters of dilated thin-walled blood vessels that predispose individuals to seizures and stroke. Mutations in CCM1, CCM2, or CCM3 lead to cerebral cavernous malformations, one of the most common hereditary vascular diseases of the brain. Endothelial cells within these lesions are the main disease compartments. Here, we show that adenoviral CCM3 expression inhibits endothelial cell migration, proliferation, and tube formation while down regulation of endogenous CCM3 results in increased formation of tube-like structures. Adenoviral CCM3 expression does not induce apoptosis under normal endothelial cell culture conditions but protects endothelial cells from staurosporine-induced cell death. Tyrosine kinase activity profiling suggests that CCM3 supports PDPK-1/Akt-mediated endothelial cell quiescence and survival (Schleider et al, Neurogenetics 12, 2011). The CCM-3 is fused to a N-terminal His-tag (6x His).
Synonyms: PDCD10, CCM3, TFAR15, programmed cell death 10 - Molecular Weight
- 26.7 kDa
- NCBI Accession
- NP_009148, NM_007217
- UniProt
- Q9BUL8
-