ARPC2 Protein (AA 1-250, partial) (GST tag)
-
- Target See all ARPC2 Proteins
- ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))
- Protein Type
- Recombinant
- Protein Characteristics
- AA 1-250, partial
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This ARPC2 protein is labelled with GST tag.
- Application
- ELISA
- Sequence
- MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDG VLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVY GSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDR VTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLF SHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNT INLIHTFRDY
- Characteristics
- Please inquire if you are interested in this recombinant protein expressed in E. coli, mammalien cells or by baculovirus infection. Be aware about differences in price and lead time.
- Purity
- 95 %
- Top Product
- Discover our top product ARPC2 Protein
-
-
- Comment
-
The yeast protein expression system is the most economical and efficient eukaryotic system for secretion and intracellular expression. A protein expressed by the mammalian cell system is of very high-quality and close to the natural protein. But the low expression level, the high cost of medium and the culture conditions restrict the promotion of mammalian cell expression systems. The yeast protein expression system serve as a eukaryotic system integrate the advantages of the mammalian cell expression system. A protein expressed by yeast system could be modificated such as glycosylation, acylation, phosphorylation and so on to ensure the native protein conformation. It can be used to produce protein material with high added value that is very close to the natural protein. Our proteins produced by yeast expression system has been used as raw materials for downstream preparation of monoclonal antibodies.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Concentration
- 0.2-2 mg/mL
- Buffer
- Tris-based buffer, 50 % glycerol
- Handling Advice
- Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week
- Storage
- -20 °C
- Storage Comment
- Store at -20 °C for extended storage, conserve at -20 °C or -80 °C
-
- Target
- ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))
- Alternative Name
- Actin-related protein 2/3 complex subunit 2 protein (ARPC2 Products)
- Synonyms
- arc34 Protein, p34-arc Protein, pnas-139 Protein, pro2446 Protein, Arpc2 Protein, Arc-p34 Protein, 2210023N03Rik Protein, 34kDa Protein, p34-Arc Protein, fk84a07 Protein, wu:fa22f07 Protein, wu:fk84a07 Protein, zgc:77769 Protein, ARC34 Protein, PNAS-139 Protein, actin related protein 2/3 complex subunit 2 Protein, actin related protein 2/3 complex, subunit 2, 34kDa Protein, actin related protein 2/3 complex, subunit 2 Protein, actin related protein 2/3 complex subunit 2 S homeolog Protein, ARPC2 Protein, arpc2 Protein, Arpc2 Protein, arpc2.S Protein
- Background
- Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.
- Molecular Weight
- 55.8 kD
- UniProt
- O15144
- Pathways
- RTK Signaling, Regulation of Actin Filament Polymerization
-