anti-Rat (Rattus) BMP2 antibody for ELISA

Recommended BMP2 Antibody (supplied by: Log in to see )

Antigen
Bone Morphogenetic Protein 2 (BMP2) Antibodies
  • BDA2
  • BMP2A
  • AI467020
  • Bmp2a
  • BMP-2
  • xBMP-2
  • xbmp2
  • BMP2
  • bmp2a
  • bmp2
  • wu:fc59d09
  • bone morphogenetic protein 2
  • bone morphogenetic protein 2 L homeolog
  • Bone morphogenetic protein 2
  • bone morphogenetic protein 2a
  • BMP2
  • Bmp2
  • bmp2.L
  • bmp2
  • bmp2a
Epitope
AA 283-312, C-Term
47
23
15
13
11
11
9
6
6
6
5
5
5
5
5
5
5
5
5
5
3
3
3
2
2
2
2
2
1
1
1
1
Reactivity
Human, Rat (Rattus)
274
74
74
26
21
17
9
8
4
4
3
3
2
2
2
1
1
1
Host
Rabbit
221
97
8
Clonality
Polyclonal
Conjugate
This BMP2 antibody is un-conjugated
33
21
10
7
7
5
5
4
4
4
4
4
4
4
3
3
3
3
3
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
259
209
106
55
41
26
13
13
11
9
9
6
3
3
3
2
2
2
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043489
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3183525 ELISA IHC WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN3181488 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN152850 DB ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN1585575 IHC ELISA WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1100286 IHC (p) Neut ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1452960 IHC ELISA WB Rabbit IgG AA 226-275 Log in to see Polyclonal 0
1 ABIN604469 ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN2617650 ELISA Rabbit IgG AA 228-321 Log in to see Polyclonal 0
1 ABIN2887771 ELISA IHC (p) WB Rabbit IgG AA 226-275 Log in to see Polyclonal 0
1 ABIN3028513 ELISA WB Rabbit Ig Fraction Log in to see Polyclonal 0
1 ABIN2617638 ELISA WB Biotin Rabbit IgG AA 49-243 Log in to see Polyclonal 0
1 ABIN2617643 ELISA WB FITC Rabbit IgG AA 49-243 Log in to see Polyclonal 0
1 ABIN5693978 DB ELISA WB Rabbit IgG AA 45-60 Log in to see Polyclonal 0
1 ABIN2617627 ELISA WB Rabbit IgG AA 49-243 Log in to see Polyclonal 0
1 ABIN2211588 IC IHC ELISA WB Rabbit IgG AA 49-243 Log in to see Polyclonal 0
1 ABIN5697155 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN465186 ELISA WB Biotin Rabbit Log in to see Polyclonal 0
1 ABIN1171969 IHC ELISA WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1083473 ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2738597 ELISA WB Rabbit Log in to see Polyclonal 0

General

Antigen Bone Morphogenetic Protein 2 (BMP2) Antibodies
Epitope AA 283-312, C-Term
(47), (23), (15), (13), (11), (11), (9), (6), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity Human, Rat (Rattus)
(274), (74), (74), (26), (21), (17), (9), (8), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(221), (97), (8)
Clonality
Polyclonal
Conjugate This BMP2 antibody is un-conjugated
(33), (21), (10), (7), (7), (5), (5), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(259), (209), (106), (55), (41), (26), (13), (13), (11), (9), (9), (6), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Pubmed 14 references available
Supplier Log in to see

Product Details anti-BMP2 Antibody

Target Details BMP2 Application Details Handling References for anti-BMP2 antibody (ABIN3043489) Images
Purpose Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
Sequence QAKHKQRKRL KSSCKRHPLY VDFSDVGWND
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
Gene Name: bone morphogenetic protein 2
Protein Name: Bone morphogenetic protein 2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.
Isotype IgG

Target Details BMP2

Product Details anti-BMP2 Antibody Application Details Handling References for anti-BMP2 antibody (ABIN3043489) Images back to top
Antigen
Alternative Name BMP2 (BMP2 Antibody Abstract)
Background BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.

Synonyms: BDA2 antibody|BMP-2 antibody|BMP-2A antibody|Bmp2 antibody|BMP2_HUMAN antibody|BMP2A antibody|Bone morphogenetic protein 2 antibody| Bone morphogenetic protein 2A antibody
Gene ID 650
UniProt P12643
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Regulation of Muscle Cell Differentiation, Growth Factor Binding, Positive Regulation of fat Cell Differentiation

Application Details

Product Details anti-BMP2 Antibody Target Details BMP2 Handling References for anti-BMP2 antibody (ABIN3043489) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-BMP2 Antibody Target Details BMP2 Application Details References for anti-BMP2 antibody (ABIN3043489) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-BMP2 antibody (ABIN3043489)

Product Details anti-BMP2 Antibody Target Details BMP2 Application Details Handling Images back to top
Product cited in:

Liu, Chen, Zeng, Cui, Ning, Wang, Belguise, Wang, Qian, Lu, Yi: "Bone morphogenic protein-2 regulates the myogenic differentiation of PMVECs in CBDL rat serum-induced pulmonary microvascular remodeling." in: Experimental cell research, Vol. 336, Issue 1, pp. 109-18, 2015

Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, 2015

Chai, Guo, Wang, Gao, Liu, Fu, Guan, Tan, Yang: "In vitro and in vivo evaluations on osteogenesis and biodegradability of a β-tricalcium phosphate coated magnesium alloy." in: Journal of biomedical materials research. Part A, Vol. 100, Issue 2, pp. 293-304, 2014

Guo, Zeng, Yan, Shen, Liu, Li, Zhang, Wu, Guan, Huang: "Proliferative effect and osteoinductive potential of extracellular matrix coated on cell culture plates." in: SpringerPlus, Vol. 2, Issue 1, pp. 303, 2014

Sun, Sun, Tian, Xu, Zhou, Xi, Yan, Wang: "A comparison of osteocyte bioactivity in fine particulate bone powder grafts vs larger bone grafts in a rat bone repair model." in: Acta histochemica, Vol. 116, Issue 6, pp. 1015-21, 2014

Zhong, Liu, Dai, Zhou, Fu: "Sodium thiosulfate protects human aortic smooth muscle cells from osteoblastic transdifferentiation via high-level phosphate." in: The Kaohsiung journal of medical sciences, Vol. 29, Issue 11, pp. 587-93, 2013

Li, Chen, Wu, Jiang, Ge, Gao, Zhang, Wu: "Enhancement of the osseointegration of a polyethylene terephthalate artificial ligament graft in a bone tunnel using 58S bioglass." in: International orthopaedics, Vol. 36, Issue 1, pp. 191-7, 2012

Wang, Liu, Dang, Ma, Zhang, Wang: "The effect of core decompression on local expression of BMP-2, PPAR-γ and bone regeneration in the steroid-induced femoral head osteonecrosis." in: BMC musculoskeletal disorders, Vol. 13, pp. 142, 2012

Chen, Kong, Wan, Xiao, Li, Wang, Lin, Wang: "Effects of huogu I formula (I) on correlated factors of bone regeneration in chickens with steroid-induced necrosis of femoral head." in: Chinese journal of integrative medicine, Vol. 18, Issue 5, pp. 378-84, 2012

Yao, Wang, Wang, Wang, Zhang, Liu: "Synergistic enhancement of new bone formation by recombinant human bone morphogenetic protein-2 and osteoprotegerin in trans-sutural distraction osteogenesis: a pilot study in dogs." in: Journal of oral and maxillofacial surgery : official journal of the American Association of Oral and Maxillofacial Surgeons, Vol. 69, Issue 11, pp. e446-55, 2011

Han, Li, Guan: "Ectopic osteogenesis of hBMP-2 gene-transduced human bone mesenchymal stem cells/BCB." in: Connective tissue research, Vol. 51, Issue 4, pp. 274-81, 2010

Liu, Zhong, Liang, Fu, Luo, Zhou, Gou, Huang: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." in: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, 2010

Ma, Ma, Guo, Zhang: "Expression of bone morphogenetic protein-2 and its receptors in epithelial ovarian cancer and their influence on the prognosis of ovarian cancer patients." in: Journal of experimental & clinical cancer research : CR, Vol. 29, pp. 85, 2010

Tian, Sun, Zhang, Gao, Fu, Yang: "Construction and expression of a bicistronic vector containing human bone morphogenetic protein 2 and vascular endothelial growth factor-165 genes in vitro." in: Chinese medical journal, Vol. 122, Issue 4, pp. 471-3, 2009

Images

Product Details anti-BMP2 Antibody Target Details BMP2 Application Details Handling References for anti-BMP2 antibody (ABIN3043489) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Bone Morphogenetic Protein 2 (BMP2) (AA 283-312), (C-Term) antibody (ABIN3043489) IHC(P): Human Intestinal Cancer Tissue
Western Blotting (WB) image for anti-Bone Morphogenetic Protein 2 (BMP2) (AA 283-312), (C-Term) antibody (ABIN3043489) anti-Bone Morphogenetic Protein 2 (BMP2) (AA 283-312), (C-Term) antibody (Image 2)