anti-Human Glucose-6-Phosphate Dehydrogenase antibody for Immunofluorescence

Recommended Glucose-6-Phosphate Dehydrogenase Antibody (supplied by: Log in to see )

Antigen
Glucose-6-Phosphate Dehydrogenase (G6PD) Antibodies
  • G6PD1
  • g6pd
  • G6pd
  • G6pdx
  • g6pdh
  • g6pd2
  • fj78b06
  • wu:fj78b06
  • si:dkey-90a13.8
  • BA3433
  • G28A
  • G6PD
  • Gpdx
  • glucose-6-phosphate dehydrogenase
  • glucose-6-phosphate 1-dehydrogenase
  • glucose-6-phosphate 1-dehydrogenase (G6PD)
  • glucose-6-P dehydrogenase
  • glucose-6-phosphate dehydrogenase L homeolog
  • glucose-6-phosphate 1-dehydrogenase Zwf
  • glucose-6-phosphate dehydrogenase X-linked
  • G6PD
  • g6pd
  • g6pD
  • zwf
  • LOC100120232
  • LACBIDRAFT_188936
  • G6pd
  • g6pd.L
  • CNG03280
  • Tb10.70.5200
  • G6pdx
Reactivity
Human
296
106
75
17
12
12
9
6
6
3
3
3
2
2
2
1
1
1
Host
Rabbit
192
97
65
Clonality
Polyclonal
Conjugate
This Glucose-6-Phosphate Dehydrogenase antibody is un-conjugated
28
16
15
8
8
5
5
4
4
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
289
163
133
82
82
61
35
27
22
21
18
12
10
9
6
5
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4314534
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.610358 ABIN4314533 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 3
10.610358 ABIN450006 ELISA FACS ICC IF WB Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
10.610358 ABIN2966697 IC IF IHC WB Rabbit Log in to see Polyclonal 0
10.610358 ABIN2722393 FACS IF WB Mouse IgG2a Log in to see 3H5 0
10.610358 ABIN4314526 FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 2A7 0
10.610358 ABIN4891709 ICC IF WB Rabbit N-Term Log in to see Polyclonal 0
10.610358 ABIN515876 IF WB Rabbit AA 1-515, full length Log in to see Polyclonal 0
1 ABIN1498353 FACS IF WB Mouse IgG2a Log in to see 3H5 0
1 ABIN5950820 FACS ICC IF IHC IHC (p) WB Rabbit IgG AA 1-300 Log in to see JA31-40 0
1 ABIN2722391 FACS IF IHC WB Mouse IgG2b Log in to see 2C12 0
1 ABIN2722392 FACS IF IHC WB Mouse IgG1 Log in to see 1H6 0
1 ABIN2722394 FACS IF IHC WB Mouse IgG1 Log in to see 2A7 0
1 ABIN2605220 FACS IF IHC IHC (p) WB Mouse IgG1 Log in to see 1H6 0
1 ABIN4314537 ELISA FACS ICC IF WB Alexa Fluor 488 Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
1 ABIN4314551 ELISA FACS ICC IF WB DyLight 550 Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
1 ABIN4314544 ELISA FACS ICC IF FITC Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
1 ABIN4314539 ELISA FACS ICC IF WB Alexa Fluor 647 Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
1 ABIN4314553 ELISA FACS ICC IF WB DyLight 405 Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
1 ABIN4314552 ELISA FACS ICC IF WB DyLight 350 Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0
1 ABIN4314545 ELISA FACS ICC IF WB DyLight 680 Mouse IgG2b kappa AA 35-506 Log in to see 2F6 0

General

Antigen Glucose-6-Phosphate Dehydrogenase (G6PD) Antibodies
Reactivity Human
(296), (106), (75), (17), (12), (12), (9), (6), (6), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(192), (97), (65)
Clonality
Polyclonal
Conjugate This Glucose-6-Phosphate Dehydrogenase antibody is un-conjugated
(28), (16), (15), (8), (8), (5), (5), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(289), (163), (133), (82), (82), (61), (35), (27), (22), (21), (18), (12), (10), (9), (6), (5), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody

Target Details Glucose-6-Phosphate Dehydrogenase Application Details Handling References for anti-Glucose-6-Phosphate Dehydrogenase antibody (ABIN4314534) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP
Isotype IgG
Plasmids, Primers & others

Target Details Glucose-6-Phosphate Dehydrogenase

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody Application Details Handling References for anti-Glucose-6-Phosphate Dehydrogenase antibody (ABIN4314534) Images back to top
Antigen
Alternative Name Glucose 6 Phosphate Dehydrogenase (G6PD Antibody Abstract)
Background Gene Symbol: G6PD
Gene ID 2539
Pathways Regulation of Systemic Arterial Blood Pressure by Hormones

Application Details

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody Target Details Glucose-6-Phosphate Dehydrogenase Handling References for anti-Glucose-6-Phosphate Dehydrogenase antibody (ABIN4314534) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody Target Details Glucose-6-Phosphate Dehydrogenase Application Details References for anti-Glucose-6-Phosphate Dehydrogenase antibody (ABIN4314534) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Glucose-6-Phosphate Dehydrogenase antibody (ABIN4314534)

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody Target Details Glucose-6-Phosphate Dehydrogenase Application Details Handling Images back to top
Product cited in:

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013

Dammeyer, Arnér: "Human Protein Atlas of redox systems - what can be learnt?" in: Biochimica et biophysica acta, Vol. 1810, Issue 1, pp. 111-38, 2010

Images

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody Target Details Glucose-6-Phosphate Dehydrogenase Application Details Handling References for anti-Glucose-6-Phosphate Dehydrogenase antibody (ABIN4314534) back to top
Supplier Images
Western Blotting (WB) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Lane 1: Marke...
Immunofluorescence (IF) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunocytochemistry/Immunofluorescence: Glucose 6 Phosphate Dehydrogenase Antibody [N...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805...
Immunofluorescence (IF) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunofluorescence: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Analysi...
Immunofluorescence (IF) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunocytochemistry/Immunofluorescence: Glucose 6 Phosphate Dehydrogenase Antibody -...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Western Blotting (WB) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody 206, 113, 82, 49, 32, 26, 1...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Western Blotting (WB) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody - Analysis in human cell li...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Glucose-6-Phosphate Dehydrogenase (G6PD) antibody (ABIN4314534) Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody - Staining...