anti-Human ASS1 antibody for Immunofluorescence

Recommended ASS1 Antibody (supplied by: Log in to see )

Antigen
Argininosuccinate Synthase 1 (ASS1) Antibodies
  • ASS
  • CTLN1
  • AA408052
  • Ass-1
  • fold
  • ASSA
  • Ass
  • ass
  • zgc:92051
  • wu:fb95a04
  • wu:fc01e08
  • argininosuccinate synthase 1
  • argininosuccinate synthetase 1
  • argininosuccinate synthase 1 S homeolog
  • ASS1
  • Ass1
  • ass1.S
  • ass1
Reactivity
Human
146
61
44
38
9
8
2
2
1
1
1
Host
Rabbit
65
55
26
Clonality
Polyclonal
Conjugate
This ASS1 antibody is un-conjugated
8
6
6
4
4
3
2
2
2
2
2
2
2
2
2
2
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
131
100
70
45
37
28
23
22
6
4
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4281472
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.348525 ABIN4281473 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
11.348525 ABIN4281471 CyTOF ELISA FACS ICC IF WB Mouse IgG1 Log in to see 2B10 0
11.348525 ABIN1105454 EIA FACS IF WB Mouse IgG1 Log in to see 2B10 1
11.348525 ABIN3030022 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 192-221 Log in to see Polyclonal 0
11.348525 ABIN5573059 ELISA FACS IF WB Mouse IgG1 Log in to see 2B10 0
11.348525 ABIN947587 IF ELISA Mouse IgG2a kappa AA 121-220, partial Log in to see 2D2 0
1 ABIN2466477 IF IP IHC ELISA WB Goat Internal Region Log in to see Polyclonal 0
1 ABIN5553322 EIA IF IHC (p) IP WB Goat Internal Region Log in to see Polyclonal 0
1 ABIN5958920 ELISA IF IHC WB Mouse IgG1 Log in to see 25 0
1 ABIN5609721 ELISA IF IHC IP WB Biotin Goat Internal Region Log in to see Polyclonal 0
1 ABIN1832870 ICC IF Rabbit IgG AA 155-412 Log in to see Polyclonal 0
1 ABIN1827403 IF ELISA Mouse IgG2a, kappa AA 121-220 Log in to see 2D2 0
1 ABIN2561198 IF IP IHC ELISA WB Goat IgG Internal Region Log in to see Polyclonal 0
1 ABIN5075096 ELISA ICC IF WB Mouse IgG2a kappa AA 1-412 Log in to see 1G11 0
1 ABIN1976828 FACS IF IHC IHC (p) WB Rabbit AA 192-221 Log in to see Polyclonal 0
1 ABIN5700290 ELISA IF IHC WB Mouse IgG1 Log in to see 0
1 ABIN1886069 IF IHC WB Rabbit AA 155-410 Log in to see Polyclonal 0
1 ABIN2205576 FACS IF IHC WB Rabbit AA 192-221 Log in to see Polyclonal 0
1 ABIN2961949 FACS IF IHC (p) WB Rabbit AA 192-221, Internal Region Log in to see Polyclonal 0
1 ABIN2205584 IF IP IHC ELISA WB Goat Log in to see Polyclonal 0

General

Antigen Argininosuccinate Synthase 1 (ASS1) Antibodies
Reactivity Human
(146), (61), (44), (38), (9), (8), (2), (2), (1), (1), (1)
Host Rabbit
(65), (55), (26)
Clonality
Polyclonal
Conjugate This ASS1 antibody is un-conjugated
(8), (6), (6), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(131), (100), (70), (45), (37), (28), (23), (22), (6), (4), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-ASS1 Antibody

Target Details ASS1 Application Details Handling References for anti-ASS1 antibody (ABIN4281472) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
Isotype IgG
Plasmids, Primers & others

Target Details ASS1

Product Details anti-ASS1 Antibody Application Details Handling References for anti-ASS1 antibody (ABIN4281472) Images back to top
Antigen
Alternative Name Argininosuccinate Synthase (ASS1 Antibody Abstract)
Background Gene Symbol: ASS1
Gene ID 445
Pathways Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin

Application Details

Product Details anti-ASS1 Antibody Target Details ASS1 Handling References for anti-ASS1 antibody (ABIN4281472) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ASS1 Antibody Target Details ASS1 Application Details References for anti-ASS1 antibody (ABIN4281472) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-ASS1 antibody (ABIN4281472)

Product Details anti-ASS1 Antibody Target Details ASS1 Application Details Handling Images back to top
Product cited in:

Slebos, Jehmlich, Brown, Yin, Chung, Yarbrough, Liebler: "Proteomic analysis of oropharyngeal carcinomas reveals novel HPV-associated biological pathways." in: International journal of cancer, Vol. 132, Issue 3, pp. 568-79, 2012

Images

Product Details anti-ASS1 Antibody Target Details ASS1 Application Details Handling References for anti-ASS1 antibody (ABIN4281472) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Immunocytochemistry/Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-888...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Sta...
Western Blotting (WB) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Western Blot: Argininosuccinate Synthase Antibody [NBP1-88867] - Lane 1: Marker [kDa]...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody - Staining in hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody - Staining of hum...
Western Blotting (WB) image for anti-Argininosuccinate Synthase 1 (ASS1) antibody (ABIN4281472) Western Blot: Argininosuccinate Synthase Antibody - Analysis in human cell lines MCF...