anti-Rat (Rattus) HER2 antibody for Western Blotting

Recommended HER2 Antibody (supplied by: Log in to see )

Antigen
V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) Antibodies
  • CD340
  • HER-2
  • HER-2/neu
  • HER2
  • MLN 19
  • NEU
  • NGL
  • TKR1
  • Erbb-2
  • Neu
  • c-erbB2
  • c-neu
  • mKIAA3023
  • wu:fv70f10
  • zgc:63601
  • erb2
  • erb-b2 receptor tyrosine kinase 2
  • ERBB2
  • Erbb2
  • erbb2
Epitope
AA 29-64, N-Term
130
87
71
69
60
48
48
35
31
25
23
22
22
15
14
13
13
13
12
12
12
11
11
11
11
10
10
10
10
10
10
9
9
8
7
7
7
6
6
6
6
5
5
5
5
4
4
4
4
4
4
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Rat (Rattus)
1294
405
312
31
22
10
6
6
6
4
4
3
3
3
3
3
2
2
2
2
1
1
1
Host
Rabbit
772
584
23
16
10
3
3
Clonality
Polyclonal
Conjugate
This HER2 antibody is un-conjugated
57
44
44
42
41
27
18
18
11
11
11
10
10
9
8
8
8
8
8
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
2
2
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
671
453
412
411
352
192
191
102
100
99
96
47
24
21
18
11
6
3
3
3
2
1
1
1
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5518830
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.064927 ABIN4309121 ICC IF IHC IHC (p) WB Rabbit pTyr1248 Log in to see Polyclonal 2
3.064927 ABIN2704879 IP IHC WB Rabbit C-Term Log in to see Polyclonal 0
3.064927 ABIN1532014 ELISA WB Rabbit IgG AA 1081-1130, pTyr1112 Log in to see Polyclonal 2
3.064927 ABIN1532623 IHC ELISA WB Rabbit IgG AA 661-710 Log in to see Polyclonal 2
3.064927 ABIN1533053 ELISA WB Rabbit IgG AA 1081-1130 Log in to see Polyclonal 2
3.064927 ABIN4309119 ICC IF IHC IHC (p) WB Rabbit pTyr877 Log in to see Polyclonal 1
3.064927 ABIN2957599 IHC WB Rabbit Log in to see Polyclonal 0
3.064927 ABIN2957598 IC IF IHC WB Rabbit Log in to see Polyclonal 0
3.064927 ABIN1534423 IF IHC ELISA WB Rabbit IgG AA 641-690 Log in to see Polyclonal 1
3.064927 ABIN1531861 ELISA IHC IP WB Rabbit IgG AA 851-900, pTyr877 Log in to see Polyclonal 0
3.064927 ABIN1531859 ELISA IHC IP WB Rabbit IgG AA 1191-1240, pTyr1221 Log in to see Polyclonal 0
3.064927 ABIN1532890 IHC ELISA WB Rabbit IgG AA 1191-1240 Log in to see Polyclonal 0
3.064927 ABIN1532891 IHC ELISA WB Rabbit IgG AA 1206-1255 Log in to see Polyclonal 0
3.064927 ABIN1532892 IHC ELISA WB Rabbit IgG AA 851-900 Log in to see Polyclonal 0
3.064927 ABIN1531860 IHC ELISA WB Rabbit IgG AA 1206-1255, pTyr1248 Log in to see Polyclonal 0
3.064927 ABIN126789 IF WB Mouse IgG1 pTyr1112 Log in to see 19G5 0
3.064927 ABIN1870163 IF IHC WB Rabbit IgG pTyr877 Log in to see Polyclonal 0
3.064927 ABIN1870167 IF IHC WB Rabbit IgG pTyr1248 Log in to see Polyclonal 0
3.064927 ABIN4309122 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
3.064927 ABIN1846011 IP IHC WB Rabbit pTyr877 Log in to see Polyclonal 0

General

Antigen V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) Antibodies
Epitope AA 29-64, N-Term
(130), (87), (71), (69), (60), (48), (48), (35), (31), (25), (23), (22), (22), (15), (14), (13), (13), (13), (12), (12), (12), (11), (11), (11), (11), (10), (10), (10), (10), (10), (10), (9), (9), (8), (7), (7), (7), (6), (6), (6), (6), (5), (5), (5), (5), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Rat (Rattus)
(1294), (405), (312), (31), (22), (10), (6), (6), (6), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(772), (584), (23), (16), (10), (3), (3)
Clonality
Polyclonal
Conjugate This HER2 antibody is un-conjugated
(57), (44), (44), (42), (41), (27), (18), (18), (11), (11), (11), (10), (10), (9), (8), (8), (8), (8), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (2), (2), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(671), (453), (412), (411), (352), (192), (191), (102), (100), (99), (96), (47), (24), (21), (18), (11), (6), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-HER2 Antibody

Target Details HER2 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Sequence TDMKLRLPAS PETHLDMLRH LYQGCQVVQG NLELTY
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: erb-b2 receptor tyrosine kinase 2
Protein Name: Receptor tyrosine-protein kinase erbB-2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences.
Isotype IgG
Plasmids, Primers & others

Target Details HER2

Product Details anti-HER2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ERBB2 (ERBB2 Antibody Abstract)
Background Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Synonyms: C erb B2/neu protein | Cerb B2/neu protein | CD340 | CD340 antigen | CerbB2 | ERBB2 | HER 2 | HER 2/NEU | HER2 | Herstatin | MLN19 | MLN 19 | NEU | NGL | p185erbB2 | TKR1 | P04626
Gene ID 2064
UniProt P04626
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development

Application Details

Product Details anti-HER2 Antibody Target Details HER2 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-HER2 Antibody Target Details HER2 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-HER2 Antibody Target Details HER2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) (AA 29-64), (N-Term) antibody (ABIN5518830) Western blot analysis of ErbB 2 using anti- ErbB 2 antibody . Electrophoresis was pe...
Immunohistochemistry (IHC) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) (AA 29-64), (N-Term) antibody (ABIN5518830) IHC analysis of ErbB 2 using anti- ErbB 2 antibody . ErbB 2 was detected in paraffin-...
Immunohistochemistry (IHC) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) (AA 29-64), (N-Term) antibody (ABIN5518830) IHC analysis of ErbB 2 using anti- ErbB 2 antibody . ErbB 2 was detected in paraffin-...