anti-Chicken WASF3 antibody for Western Blotting

Recommended WASF3 Antibody (supplied by: Log in to see )

WAS Protein Family, Member 3 (WASF3) Antibodies
  • wu:fb74d08
  • wu:fi28e02
  • zgc:158236
  • Brush-1
  • SCAR3
  • WAVE3
  • Scar3
  • Wave3
  • WAS protein family, member 3b
  • WAS protein family member 3
  • WAS protein family, member 3
  • wasf3b
  • WASF3
  • Wasf3
Chicken, Human
This WASF3 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4890461
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.283734 ABIN4890462 WB Rabbit Log in to see Polyclonal 0
1 ABIN321927 WB Rabbit IgG AA 96-145 Log in to see Polyclonal 0
1 ABIN321928 WB Rabbit IgG AA 184-233 Log in to see Polyclonal 0
1 ABIN4251771 WB Rabbit N-Term Log in to see Polyclonal 0
1 ABIN4251773 WB Rabbit Log in to see Polyclonal 0


Antigen WAS Protein Family, Member 3 (WASF3) Antibodies
Epitope N-Term
(7), (4), (4), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1)
Reactivity Chicken, Human
(52), (36), (23), (6), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1)
Host Rabbit
(49), (3), (1)
Conjugate This WASF3 antibody is un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(35), (13), (9), (7), (5), (4)
Supplier Log in to see

Product Details anti-WASF3 Antibody

Target Details WASF3 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the N terminal of WASF3. Peptide sequence NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK.

Target Details WASF3

Product Details anti-WASF3 Antibody Application Details Handling Images back to top
Alternative Name WASF3/WAVE3 (WASF3 Antibody Abstract)
Background Gene Symbol: WASF3
Molecular Weight Theoretical MW: 55 kDa
Gene ID 10810
UniProt Q9UPY6
Pathways RTK Signaling

Application Details

Product Details anti-WASF3 Antibody Target Details WASF3 Handling Images back to top
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against WASF3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-WASF3 Antibody Target Details WASF3 Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-WASF3 Antibody Target Details WASF3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-WAS Protein Family, Member 3 (WASF3) (N-Term) antibody (ABIN4890461) Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - Titration: 0.2-1 ug/ml Positive Con...
Western Blotting (WB) image for anti-WAS Protein Family, Member 3 (WASF3) (N-Term) antibody (ABIN4890461) Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - 1. DF-1 cells (0.5x106 cells loaded...
Western Blotting (WB) image for anti-WAS Protein Family, Member 3 (WASF3) (N-Term) antibody (ABIN4890461) Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - Sample Type: 1. DF-1 cells (0.5x10^...