anti-Human WIPF1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended WIPF1 Antibody (supplied by: Log in to see )

Antigen
WAS/WASL Interacting Protein Family, Member 1 (WIPF1) Antibodies
  • WASPIP
  • PRPL-2
  • WIP
  • AI115543
  • D2Ertd120e
  • Waspip
  • Wip
  • WAS/WASL interacting protein family member 1
  • WAS/WASL interacting protein family, member 1
  • WIPF1
  • Wipf1
Reactivity
Human
38
20
16
3
2
2
2
1
1
1
Host
Rabbit
19
17
2
Clonality
Polyclonal
Conjugate
This WIPF1 antibody is un-conjugated
2
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
33
24
5
2
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4366109
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5590930 IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN2735593 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen WAS/WASL Interacting Protein Family, Member 1 (WIPF1) Antibodies
Reactivity Human
(38), (20), (16), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(19), (17), (2)
Clonality
Polyclonal
Conjugate This WIPF1 antibody is un-conjugated
(2), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(33), (24), (5), (2), (2), (2), (2)
Supplier Log in to see

Product Details anti-WIPF1 Antibody

Target Details WIPF1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAP
Isotype IgG
Plasmids, Primers & others

Target Details WIPF1

Product Details anti-WIPF1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name WIPF1/WIP (WIPF1 Antibody Abstract)
Background Gene Symbol: WIPF1
Gene ID 7456
Pathways RTK Signaling

Application Details

Product Details anti-WIPF1 Antibody Target Details WIPF1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-WIPF1 Antibody Target Details WIPF1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-WIPF1 Antibody Target Details WIPF1 Application Details Handling back to top
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-WAS/WASL Interacting Protein Family, Member 1 (WIPF1) antibody (ABIN4366109) Immunohistochemistry-Paraffin: WIPF1/WIP Antibody - Staining of human spleen shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WAS/WASL Interacting Protein Family, Member 1 (WIPF1) antibody (ABIN4366109) Immunohistochemistry-Paraffin: WIPF1/WIP Antibody - Staining of human pancreas shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WAS/WASL Interacting Protein Family, Member 1 (WIPF1) antibody (ABIN4366109) Immunohistochemistry-Paraffin: WIPF1/WIP Antibody - Staining in human spleen and pan...
Western Blotting (WB) image for anti-WAS/WASL Interacting Protein Family, Member 1 (WIPF1) antibody (ABIN4366109) Western Blot: WIPF1/WIP Antibody - Lane 1: Marker 250, 130, 100, 70, 55, 35, 25, 15...