anti-Dog (Canine) Replication Factor C (Activator 1) 3, 38kDa antibody for Western Blotting

Recommended Replication Factor C (Activator 1) 3, 38kDa Antibody (supplied by: Log in to see )

Antigen
Replication Factor C (Activator 1) 3, 38kDa (RFC3) Antibodies
  • CG5313
  • DRFC
  • DmRFC3
  • Dmel\\CG5313
  • Rfc3
  • 21.m02902
  • 2810416I22Rik
  • 38kDa
  • AU022547
  • Recc3
  • cb275
  • RFC38
  • Replication factor C subunit 3
  • replication factor C3
  • replication factor C subunit 3
  • replication factor C 38 kDa subunit
  • DNA replication factor C complex subunit Rfc3
  • replication factor C3, putative
  • replication factor C (activator 1) 3
  • replication factor C subunit 3 L homeolog
  • RfC3
  • PF14_0601
  • Chro.30359
  • PB000006.01.0
  • PC000345.04.0
  • TP04_0380
  • Tb09.211.3310
  • PY04255
  • PVX_117300
  • BBOV_IV003080
  • SJAG_02182
  • PKH_124240
  • rfc3
  • Rfc3
  • RFC3
  • rfc3.L
Reactivity
Human, Dog (Canine)
58
28
26
9
7
5
4
3
3
3
3
2
1
1
1
Host
Rabbit
48
9
1
Clonality
Polyclonal
Application
Western Blotting (WB)
56
21
13
9
8
5
3
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN634080
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.343901 ABIN2782474 WB Rabbit C-Term Log in to see Polyclonal 1
4.8439007 ABIN2782475 WB Rabbit N-Term Log in to see Polyclonal 1
4.8439007 ABIN2462934 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN6738210 WB Rabbit IgG C-Term Log in to see Polyclonal 0
4 ABIN6738211 WB Rabbit IgG AA 91-140 Log in to see Polyclonal 0
1 ABIN1930251 IF IHC IHC (p) WB Rabbit IgG AA 80-110 Log in to see Polyclonal 0

General

Antigen Replication Factor C (Activator 1) 3, 38kDa (RFC3) Antibodies
Reactivity Human, Dog (Canine)
(58), (28), (26), (9), (7), (5), (4), (3), (3), (3), (3), (2), (1), (1), (1)
Host Rabbit
(48), (9), (1)
Clonality
Polyclonal
Application Western Blotting (WB)
(56), (21), (13), (9), (8), (5), (3), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purification Affinity purified
Immunogen RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name RFC3 (RFC3 Antibody Abstract)
Background The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.
Molecular Weight 40 kDa (MW of target protein)
Pathways Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

RFC3 Blocking Peptide, catalog no. 33R-10126, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Replication Factor C (Activator 1) 3, 38kDa (RFC3) antibody (ABIN634080) RFC3 antibody used at 1 ug/ml to detect target protein.