anti-Human FZD6 antibody for Western Blotting

Recommended FZD6 Antibody (supplied by: Log in to see )

Frizzled Family Receptor 6 (FZD6) Antibodies
  • zgc:65879
  • zgc:77440
  • fz6
  • frz6
  • Xfrz6
  • frizzled6
  • frizzled-6
  • FZ-6
  • FZ6
  • HFZ6
  • NDNC10
  • Frizzled-6
  • Fz6
  • frizzled class receptor 6
  • frizzled class receptor 6 S homeolog
  • fzd6
  • fzd6.S
  • FZD6
  • Fzd6
This FZD6 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN635881
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
15.753838 ABIN6140848 WB Rabbit Log in to see Polyclonal 0
12.026281 ABIN3184689 ELISA IF WB Rabbit IgG Internal Region Log in to see Polyclonal 0
12.026281 ABIN3184690 ELISA IF IHC WB Rabbit IgG Internal Region Log in to see Polyclonal 0
12.026281 ABIN5619680 WB Rabbit Center Log in to see Polyclonal 0
12.026281 ABIN5619681 IP WB Rabbit Center Log in to see Polyclonal 0
12.026281 ABIN2142191 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
10.727556 ABIN6258792 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
8.5 ABIN4899378 CyTOF FACS IHC WB Goat IgG AA 19-153 Log in to see Polyclonal 1
7.727556 ABIN4903718 WB Rabbit IgG Log in to see Polyclonal 0
7 ABIN1713791 IF (p) IHC (p) WB Rabbit IgG AA 19-50 Log in to see Polyclonal 0
7 ABIN1576618 IF IHC ELISA WB Rabbit Internal Region Log in to see Polyclonal 0
4.727556 ABIN2776707 WB Rabbit Middle Region Log in to see Polyclonal 0
4.727556 ABIN2706183 WB Rabbit Center Log in to see Polyclonal 0
4.727556 ABIN2706184 IP WB Rabbit Center Log in to see Polyclonal 0
4.727556 ABIN952410 EIA WB Rabbit Ig Fraction AA 493-520, Middle Region Log in to see Polyclonal 4
4.727556 ABIN654962 WB Rabbit Ig Fraction AA 493-520, Center Log in to see Polyclonal 0
4.727556 ABIN6566959 WB Rabbit IgG Log in to see Polyclonal 0
4.727556 ABIN5997760 WB Rabbit IgG Log in to see Polyclonal 0
4.727556 ABIN2995965 WB Rabbit IgG Log in to see Polyclonal 0
4.727556 ABIN6680458 WB Rabbit Log in to see Polyclonal 0


Antigen Frizzled Family Receptor 6 (FZD6) Antibodies
Reactivity Human
(76), (41), (14), (9), (2), (2), (2), (2), (2), (2), (1)
Host Rabbit
(73), (17), (6), (2)
Conjugate This FZD6 antibody is un-conjugated
(5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(75), (35), (21), (15), (13), (9), (9), (5), (4), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-FZD6 Antibody

Target Details FZD6 Application Details Handling Images
Purification Affinity purified
Immunogen FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE
Plasmids, Primers & others

Target Details FZD6

Product Details anti-FZD6 Antibody Application Details Handling Images back to top
Alternative Name FZD6 (FZD6 Antibody Abstract)
Background This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.
Molecular Weight 79 kDa (MW of target protein)
Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-FZD6 Antibody Target Details FZD6 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

FZD6 Blocking Peptide, catalog no. 33R-3764, is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody

Restrictions For Research Use only


Product Details anti-FZD6 Antibody Target Details FZD6 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD6 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-FZD6 Antibody Target Details FZD6 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Frizzled Family Receptor 6 (FZD6) antibody (ABIN635881) FZD6 antibody used at 1 ug/ml to detect target protein.