STAT3 antibody (AA 688-722)

Catalog No. ABIN210643

Product Details anti-STAT3 Antibody

Target: STAT3 (Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3))

Binding Specificity: AA 688-722

Reactivity: Human, Mouse, Rat, Cow, Pig, Monkey, Horse, Hamster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAT3 antibody is un-conjugated

Application: Western Blotting (WB), Immunoprecipitation (IP), Immunocytochemistry (ICC), Gel Shift (GS)

Specificity: Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%) Sheep (97%) Chicken (84%).

Purification: Protein A purified

Immunogen: Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%), Sheep (97%), Chicken (84%).

Type of Immunogen: Fusion protein

Isotype: IgG

Application Details

Application Notes: Approved: GS, ICC (10 μg/mL), IP, WB (2 - 4 μg/mL)

Usage: Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 μg/mL detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 μg/mL shows positive immunostaining for STAT 3 in A431 cells fixed with 95 % ethanol, 5 % acetic acid. Immunoprecipitation: 4 μg immunoprecipitates STAT 3 from 500 μg of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: 0.1 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 40 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeat freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Target Details for STAT3

Target: STAT3 (Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3))

Alternative Name: STAT3 (STAT3 Products)

Synonyms: 1110034C02Rik antibody, AW109958 antibody, Aprf antibody, APRF antibody, HIES antibody, Xstat3 antibody, aprf antibody, hies antibody, stat3 antibody, wu:fc15d02 antibody, wu:fl59g06 antibody, z-Stat3 antibody, signal transducer and activator of transcription 3 antibody, signal transduction and activation of transcription 3 antibody, signal transducer and activator of transcription 3, gene 1 L homeolog antibody, signal transducer and activator of transcription 3 (acute-phase response factor) antibody, STAT3 antibody, stat3 antibody, Stat3 antibody, stat3.1.L antibody

Background: Name/Gene ID: STAT3

Synonyms: STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES

Gene ID: 6774

UniProt: P40763

Pathways: JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Dopaminergic Neurogenesis, Response to Growth Hormone Stimulus, Carbohydrate Homeostasis, Stem Cell Maintenance, Hepatitis C, Protein targeting to Nucleus, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor