MGMT antibody (Middle Region)

Catalog No. ABIN631949

Product Details anti-MGMT Antibody

Target: MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MGMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MGMT antibody was raised against the middle region of MGMT

Purification: Affinity purified

Immunogen: MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGMT Blocking Peptide, catalog no. 33R-4170, is also available for use as a blocking control in assays to test for specificity of this MGMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MGMT

Target: MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))

Alternative Name: MGMT (MGMT Products)

Synonyms: AGT antibody, AI267024 antibody, Agat antibody, O-6-methylguanine-DNA methyltransferase antibody, MGMT antibody, Mgmt antibody

Background: MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: DNA Damage Repair, Positive Regulation of Response to DNA Damage Stimulus