HGF antibody

Catalog No. ABIN635210

The Rabbit Polyclonal anti-HGF antibody is suitable to detect HGF in samples from Human, Rat, Mouse and Dog. It has been validated for WB.

Quick Overview for HGF antibody (ABIN635210)

Target: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HGF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HGF Antibody

Purification: Affinity purified

Immunogen: HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HGF Blocking Peptide, (ABIN5614000), is also available for use as a blocking control in assays to test for specificity of this HGF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HGF

Target: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Alternative Name: HGF

Background: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration.

Molecular Weight: 79 kDa (MW of target protein)

Pathways: RTK Signaling, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor