MUC15 antibody (Middle Region)
-
- Target See all MUC15 Antibodies
- MUC15 (Mucin 15, Cell Surface Associated (MUC15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MUC15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MUC15 antibody was raised against the middle region of MUC15
- Purification
- Affinity purified
- Immunogen
- MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
- Top Product
- Discover our top product MUC15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MUC15 Blocking Peptide, catalog no. 33R-4381, is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUC15 (Mucin 15, Cell Surface Associated (MUC15))
- Alternative Name
- MUC15 (MUC15 Products)
- Synonyms
- 4732460E09 antibody, D730046L02Rik antibody, MUC-15 antibody, PAS3 antibody, PASIII antibody, mucin 15, cell surface associated antibody, mucin 15 antibody, MUC15 antibody, Muc15 antibody
- Background
- MUC15 may play a role in the cell adhesion to the extracellular matrix.
- Molecular Weight
- 36 kDa (MW of target protein)
-