Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CYP1A1 antibody (Middle Region)

CYP1A1 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635829
  • Target See all CYP1A1 Antibodies
    CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))
    Binding Specificity
    • 10
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 54
    • 25
    • 13
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 37
    • 23
    • 1
    Rabbit
    Clonality
    • 40
    • 21
    Polyclonal
    Conjugate
    • 39
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This CYP1A1 antibody is un-conjugated
    Application
    • 47
    • 27
    • 17
    • 7
    • 6
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    Western Blotting (WB)
    Specificity
    CYP1 A1 antibody was raised against the middle region of CYP1 1
    Purification
    Affinity purified
    Immunogen
    CYP1 A1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
    Top Product
    Discover our top product CYP1A1 Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    CYP1A1 Blocking Peptide, catalog no. 33R-2944, is also available for use as a blocking control in assays to test for specificity of this CYP1A1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))
    Alternative Name
    CYP1A1 (CYP1A1 Products)
    Synonyms
    AHH antibody, AHRR antibody, CP11 antibody, CYP1 antibody, P1-450 antibody, P450-C antibody, P450DX antibody, Cyp1a2 antibody, P450-1 antibody, cyp1a1 antibody, CYP1A1 antibody, CYPIA1 antibody, Cyp45c antibody, Cypc45c antibody, P-450MC antibody, wu:fb63b04 antibody, zfCYP1A antibody, zgc:109747 antibody, ahh antibody, ahrr antibody, cp11 antibody, cyp1 antibody, cyp1a antibody, p1-450 antibody, p450-c antibody, p450dx antibody, cytochrome P450 family 1 subfamily A member 1 antibody, cytochrome P450 1A1 antibody, cytochrome P450, family 1, subfamily a, polypeptide 1 antibody, cytochrome P450, family 1, subfamily A, polypeptide 1 antibody, cytochrome P450 family 1 subfamily D polypeptide 1 antibody, cytochrome P4501A1 antibody, polycyclic hydrocarbon-inducible cytochrome P450c antibody, cytochrome P450, family 1, subfamily A antibody, cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1 antibody, cytochrome P450 family 1 subfamily A member 1 L homeolog antibody, CYP1A1 antibody, CpipJ_CPIJ010542 antibody, Cyp1a1 antibody, cyp1d1 antibody, LOC100328613 antibody, cyp1a antibody, LOC102129994 antibody, cyp1a1.L antibody
    Background
    CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown, however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk.
    Molecular Weight
    58 kDa (MW of target protein)
    Pathways
    Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
You are here:
Support