anti-Human Calpain S1 antibody for Immunocytochemistry

Recommended Calpain S1 Antibody (supplied by: Log in to see )

Antigen
Calpain, Small Subunit 1 (CAPNS1) Antibodies
  • CAPNS1
  • MGC84330
  • 30K
  • CALPAIN4
  • CANP
  • CANPS
  • CAPN4
  • CDPS
  • CSS1
  • Capn4
  • Capa-4
  • Capa4
  • D7Ertd146e
  • calpain, small subunit 1
  • CAPNS1
  • capns1
  • Capns1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
41
14
13
3
2
2
1
1
1
1
1
1
Host
Rabbit
26
15
Clonality
Polyclonal
Conjugate
This Calpain S1 antibody is un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
32
14
11
9
7
7
5
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4287346
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4287347 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN5075475 ELISA FACS ICC IF WB Mouse IgG1 kappa AA 84-268 Log in to see 1D11
1 ABIN5075474 ELISA FACS ICC IF WB Mouse IgG1 kappa AA 84-268 Log in to see 1D11
1 ABIN5621563 ELISA FACS ICC WB Mouse IgG1 kappa AA 84-268 Log in to see AT1D11
1 ABIN1867022 ICC IHC IP WB Rabbit IgG AA 1-268 Log in to see Polyclonal
1 ABIN5540248 EIA FACS ICC IF WB Mouse IgG1 AA 84-268 Log in to see AT1D11
1 ABIN5540249 EIA FACS ICC IF WB Mouse IgG1 AA 84-268 Log in to see AT1D11

General

Antigen Calpain, Small Subunit 1 (CAPNS1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(41), (14), (13), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(26), (15)
Clonality
Polyclonal
Conjugate This Calpain S1 antibody is un-conjugated
(1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(32), (14), (11), (9), (7), (7), (5), (3), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Calpain S1 Antibody

Target Details Calpain S1 Application Details Handling References for anti-Calpain S1 antibody (ABIN4287346) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:THYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPG
Isotype IgG

Target Details Calpain S1

Product Details anti-Calpain S1 Antibody Application Details Handling References for anti-Calpain S1 antibody (ABIN4287346) Images back to top
Antigen
Alternative Name Calpain Small Subunit 1 (CAPNS1 Antibody Abstract)
Background Gene Symbol: CAPNS1
Gene ID 826
Pathways Apoptosis

Application Details

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Handling References for anti-Calpain S1 antibody (ABIN4287346) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Application Details References for anti-Calpain S1 antibody (ABIN4287346) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Calpain S1 antibody (ABIN4287346)

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Application Details Handling Images back to top
Product cited in:

Wang, Palme, Rotter, Schilcher, Cukaj, Wang, Ladurner, Heiss, Stangl, Dirsch, Atanasov: "Piperine inhibits ABCA1 degradation and promotes cholesterol efflux from THP-1-derived macrophages." in: Molecular nutrition & food research, 2016 (Sample species: Human).

Images

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Application Details Handling References for anti-Calpain S1 antibody (ABIN4287346) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calpain, Small Subunit 1 (CAPNS1) antibody (ABIN4287346) Immunohistochemistry-Paraffin: Calpain small subunit 1 Antibody [NBP1-90329] - Staini...
Immunofluorescence (IF) image for anti-Calpain, Small Subunit 1 (CAPNS1) antibody (ABIN4287346) Immunocytochemistry/Immunofluorescence: Calpain small subunit 1 Antibody [NBP1-90329]...
Western Blotting (WB) image for anti-Calpain, Small Subunit 1 (CAPNS1) antibody (ABIN4287346) Western Blot: Calpain small subunit 1 Antibody [NBP1-90329] - Lane 1: NIH-3T3 cell ly...
Western Blotting (WB) image for anti-Calpain, Small Subunit 1 (CAPNS1) antibody (ABIN4287346) Western Blot: Calpain small subunit 1 Antibody [NBP1-90329] - Lane 1: Marker [kDa] 23...