Leptin (LEP) (AA 29-164), (partial) protein (GST tag)

Details for Product No. ABIN1047335
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms LEPD, OB, OBS, ob, obese
Protein Characteristics
AA 29-164, partial
Origin
Human
(73), (37), (32), (30), (12), (11), (11), (11), (10), (10), (9), (9)
Source
Escherichia coli (E. coli)
(147), (6), (3), (2), (2)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 4 references available
Catalog no. ABIN1047335
Quantity 200 µg
Price
437.80 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence DDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHP ILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLL HVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALS RLQGSLQDMLWQLDLS
Characteristics May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Purity 90%
Alternative Name Leptin
Background Synonyms: Obese protein,Obesity factor
Molecular Weight 42.4 kD
UniProt P41159
Research Area Cardiovascular, Atherosclerosis, Hormones
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Masuzaki, Ogawa, Isse et al.: "Human obese gene expression. Adipocyte-specific expression and regional differences in the adipose tissue." in: Diabetes, Vol. 44, Issue 7, pp. 855-8, 1995 (PubMed).

Zhang, Proenca, Maffei et al.: "Positional cloning of the mouse obese gene and its human homologue." in: Nature, Vol. 372, Issue 6505, pp. 425-32, 1994 (PubMed).

Gong, Bi, Pratley et al.: "Genomic structure and promoter analysis of the human obese gene." in: The Journal of biological chemistry, Vol. 271, Issue 8, pp. 3971-4, 1996 (PubMed).

Schubring, Prohaska, Prohaska et al.: "Leptin concentrations in maternal serum and amniotic fluid during the second trimenon: differential relation to fetal gender and maternal morphometry." in: European journal of obstetrics, gynecology, and reproductive biology, Vol. 86, Issue 2, pp. 151-7, 1999 (PubMed).

Hosts (147), (6), (3), (2), (2)
Reactivities (73), (37), (32), (30), (12), (11), (11), (11), (10), (10), (9), (9)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top