anti-Caenorhabditis elegans (C. elegans) RHOC antibody for Western Blotting

Recommended RHOC Antibody (supplied by: Log in to see )

Antigen
Ras Homolog Gene Family, Member C (RHOC) Antibodies
  • ARHC
  • LOC100221682
  • ARH9
  • H9
  • RHOH9
  • AI324259
  • Arh9
  • Arhc
  • CRHOC
  • ras homolog family member C L homeolog
  • ras homolog family member C
  • rhoc.L
  • RHOC
  • rhoc
  • Rhoc
Epitope
N-Term
19
10
10
8
5
3
2
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster)
70
18
15
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Host
Rabbit
40
31
Clonality
Polyclonal
Conjugate
This RHOC antibody is un-conjugated
3
3
3
3
3
3
Application
Western Blotting (WB)
68
36
26
8
7
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634331
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0849469 ABIN2459952 ELISA WB Rabbit Log in to see Polyclonal

General

Antigen Ras Homolog Gene Family, Member C (RHOC) Antibodies
Epitope N-Term
(19), (10), (10), (8), (5), (3), (2), (2), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster)
(70), (18), (15), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(40), (31)
Clonality
Polyclonal
Conjugate This RHOC antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Western Blotting (WB)
(68), (36), (26), (8), (7), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-RHOC Antibody

Target Details RHOC Application Details Handling Images
Specificity RHOC antibody was raised against the N terminal of RHOC
Purification Affinity purified
Immunogen RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Target Details RHOC

Product Details anti-RHOC Antibody Application Details Handling Images back to top
Antigen
Alternative Name RHOC (RHOC Antibody Abstract)
Background RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.
Molecular Weight 22 kDa (MW of target protein)
Research Area Cancer
Pathways WNT Signaling, Cell-Cell Junction Organization

Application Details

Product Details anti-RHOC Antibody Target Details RHOC Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

RHOC Blocking Peptide, catalog no. 33R-9740, is also available for use as a blocking control in assays to test for specificity of this RHOC antibody

Restrictions For Research Use only

Handling

Product Details anti-RHOC Antibody Target Details RHOC Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-RHOC Antibody Target Details RHOC Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Ras Homolog Gene Family, Member C (RHOC) (N-Term) antibody (ABIN634331) RHOC antibody used at 1 ug/ml to detect target protein.