IL-21 antibody (AA 40-68)

Catalog No. ABIN1819420

Product Details anti-IL-21 Antibody

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Binding Specificity: AA 40-68

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This IL-21 antibody is un-conjugated

Application: ELISA

Specificity: Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells.

Purification: Affinity purified

Immunogen: Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%), Gibbon, Monkey, Marmoset (97%), Sheep, Bovine, Horse (93%), Elephant, Dog (90%), Panda, Cat, Pig (83%).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Application Details

Application Notes: Approved: ELISA (1:100000)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 0.09 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C. Avoid freeze-thaw cycles.

Target Details for IL-21

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Alternative Name: IL21 (IL21 Products)

Synonyms: IL-21 antibody, Za11 antibody, interleukin 21 antibody, IL21 antibody, Il21 antibody

Background: Name/Gene ID: IL21
Family: Interleukin

Synonyms: IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21

Gene ID: 59067

UniProt: Q9HBE4

Pathways: JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response