CD59 antibody (AA 25-104)
-
- Target See all CD59 Antibodies
- CD59
-
Binding Specificity
- AA 25-104
-
Reactivity
- Rabbit
-
Host
-
Guinea Pig
-
Clonality
- Polyclonal
-
Conjugate
- This CD59 antibody is un-conjugated
-
Application
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Sequence
- MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-SLMCYH CLLPSPNCST VTNCTPNHDA CLTAVSGPRV YRQCWRYEDC NFEFISNRLE ENSLKYNCCR KDLCNGPEDD GTAL
- Specificity
- It has been selected for its ability to recognize CD59 in immunohistochemical staining and Western blotting.
- Purification
- Affinity Chromatography
- Immunogen
- CD59 (AA 25-104)
- Isotype
- IgG
- Top Product
- Discover our top product CD59 Primary Antibody
-
-
- Application Notes
-
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user. - Comment
-
Content: The quality control contains recombinant CD59 (Ser25~Leu104) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % . - Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
- Preservative
- Sodium azide
- Precaution of Use
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handling Advice
- Avoid repeated freeze/thaw cycles
- Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
- Expiry Date
- 12 months
-
- Target
- CD59
- Alternative Name
- Protectin (CD59) (CD59 Products)
- Synonyms
- 16.3A5 antibody, 1F5 antibody, EJ16 antibody, EJ30 antibody, EL32 antibody, G344 antibody, HRF-20 antibody, HRF20 antibody, MAC-IP antibody, MACIF antibody, MEM43 antibody, MIC11 antibody, MIN1 antibody, MIN2 antibody, MIN3 antibody, MIRL antibody, MSK21 antibody, p18-20 antibody, Cd59a antibody, Cd59b antibody, MACIP antibody, CD59 molecule (CD59 blood group) antibody, CD59 molecule antibody, CD59 antibody, Cd59 antibody
- Pathways
- Complement System
-