VEGFA antibody
-
- Target See all VEGFA Antibodies
- VEGFA (Vascular Endothelial Growth Factor A (VEGFA))
-
Reactivity
- Human, Rat, Mouse, Pig, Dog, Rabbit, Chicken, Cow, Sheep, Guinea Pig, Horse, Monkey, Cat, Donkey, Goat, Hamster
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This VEGFA antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunofluorescence (IF)
- Specificity
- Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.
- Purification
- Immunoaffinity purified
- Immunogen
- Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)
- Isotype
- IgG
- Top Product
- Discover our top product VEGFA Primary Antibody
-
-
- Application Notes
- Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS, 20 % glycerol, 0.05 % sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
-
- Target
- VEGFA (Vascular Endothelial Growth Factor A (VEGFA))
- Alternative Name
- VEGFA / VEGF (VEGFA Products)
- Synonyms
- MVCD1 antibody, VEGF antibody, VPF antibody, Vegf antibody, Vegf120 antibody, Vegf164 antibody, Vegf188 antibody, Vpf antibody, vegf antibody, vegfa antibody, wu:fj82c06 antibody, VEGF-A antibody, VEGF164 antibody, eVEGF120 antibody, eVEGF164 antibody, vegf-a antibody, vpf antibody, vefg antibody, si:dkey-14d8.3 antibody, wu:fd42e02 antibody, vascular endothelial growth factor A antibody, vascular endothelial growth factor Aa antibody, vascular endothelial growth factor A L homeolog antibody, vascular endothelial growth factor Ab antibody, VEGFA antibody, Vegfa antibody, vegfaa antibody, vegfa.L antibody, vegfa antibody, vegfab antibody
- Background
-
Name/Gene ID: VEGFA
Family: PDGF
Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1 - Gene ID
- 7422
- UniProt
- P15692
- Pathways
- RTK Signaling, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling
-