Phospholamban antibody (AA 1-35)
-
- Target See all Phospholamban (PLN) Antibodies
- Phospholamban (PLN)
-
Binding Specificity
- AA 1-35
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Phospholamban antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Heart muscle (at protein level). .
- Purification
- Immunogen affinity purified
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product PLN Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- avoid freeze thaw cycles
- Storage
- 4 °C,-20 °C
- Storage Comment
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Target
- Phospholamban (PLN)
- Alternative Name
- PLN / Phospholamban (PLN Products)
- Synonyms
- LOC100226261 antibody, plb antibody, cmd1p antibody, CMD1P antibody, CMH18 antibody, PLB antibody, Plb antibody, Plm antibody, phospholamban antibody, PLN antibody, pln antibody, Pln antibody
- Background
-
Name/Gene ID: PLN
Synonyms: PLN, CMD1P, CMH18, PLB, Cardiac phospholamban, Phospholamban - Gene ID
- 5350
- Pathways
- Negative Regulation of Transporter Activity
-