Peroxiredoxin 4 antibody (AA 178-2081)
-
- Target See all Peroxiredoxin 4 (PRDX4) Antibodies
- Peroxiredoxin 4 (PRDX4)
-
Binding Specificity
- AA 178-2081
-
Reactivity
- Human, Mouse, Rat, Horse, Monkey, Orang-Utan
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Peroxiredoxin 4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Immunogen affinity purified
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product PRDX4 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- avoid freeze thaw cycles
- Storage
- 4 °C,-20 °C
- Storage Comment
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Target
- Peroxiredoxin 4 (PRDX4)
- Alternative Name
- PRDX4 / Peroxiredoxin 4 (PRDX4 Products)
- Synonyms
- MGC82793 antibody, prdx4 antibody, MGC79732 antibody, PRDX4 antibody, AOE37-2 antibody, PRX-4 antibody, AOE372 antibody, Prx-iv antibody, Prx4 antibody, TRANK antibody, fb59c09 antibody, wu:fb59c09 antibody, zgc:162938 antibody, peroxiredoxin 4 antibody, peroxiredoxin 4 L homeolog antibody, PRDX4 antibody, prdx4.L antibody, prdx4 antibody, Prdx4 antibody
- Background
-
Name/Gene ID: PRDX4
Synonyms: PRDX4, Antioxidant enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin peroxidase AO372, Peroxiredoxin-4, PRX-4, Peroxiredoxin 4 - Gene ID
- 10549
-