Peroxiredoxin 4 antibody (AA 178-2081)

Catalog No. ABIN2743788

Product Details anti-Peroxiredoxin 4 Antibody

Target: Peroxiredoxin 4 (PRDX4)

Binding Specificity: AA 178-2081

Reactivity: Human, Mouse, Rat, Horse, Monkey, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for Peroxiredoxin 4

Target: Peroxiredoxin 4 (PRDX4)

Alternative Name: PRDX4 / Peroxiredoxin 4 (PRDX4 Products)

Synonyms: MGC82793 antibody, prdx4 antibody, MGC79732 antibody, PRDX4 antibody, AOE37-2 antibody, PRX-4 antibody, AOE372 antibody, Prx-iv antibody, Prx4 antibody, TRANK antibody, fb59c09 antibody, wu:fb59c09 antibody, zgc:162938 antibody, peroxiredoxin 4 antibody, peroxiredoxin 4 L homeolog antibody, PRDX4 antibody, prdx4.L antibody, prdx4 antibody, Prdx4 antibody

Background: Name/Gene ID: PRDX4

Synonyms: PRDX4, Antioxidant enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin peroxidase AO372, Peroxiredoxin-4, PRX-4, Peroxiredoxin 4

Gene ID: 10549