SLC12A1 antibody (AA 52-83)

Catalog No. ABIN2744380

Product Details anti-SLC12A1 Antibody

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Binding Specificity: AA 52-83

Reactivity: Human, Rat, Mouse, Monkey

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Kidney specific.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: Approved: IHC, IHC-P (0.1 - 0.5 μg/mL), WB (0.5 - 1 μg/mL)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for SLC12A1

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Alternative Name: SLC12A1 / NKCC2 (SLC12A1 Products)

Synonyms: slc12a1 antibody, SLC12A1 antibody, DKFZp469A2020 antibody, BSC1 antibody, NKCC2 antibody, Nkcc2 antibody, AI788571 antibody, D630042G03Rik antibody, mBSC1 antibody, urehr3 antibody, si:ch211-220f12.1 antibody, solute carrier family 12 member 1 antibody, solute carrier family 12, member 1 antibody, si:ch211-220f12.1 antibody, SLC12A1 antibody, Slc12a1 antibody

Background: Name/Gene ID: SLC12A1
Subfamily: Cation:chloride symporter
Family: Transporter

Synonyms: SLC12A1, BSC1, MBSC1, Na-K-2Cl cotransporter, NKCC2A variant A, RBSC, NKCC2

Gene ID: 6557