SMN1 antibody (AA 22-52)

Catalog No. ABIN2744443

Product Details anti-SMN1 Antibody

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Binding Specificity: AA 22-52

Reactivity: Human, Mouse, Rat, Monkey, Dog, Rabbit, Chimpanzee

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMN1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level). .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for SMN1

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Alternative Name: SMN1 (SMN1 Products)

Synonyms: SMN2 antibody, Smn antibody, SMN antibody, BCD541 antibody, GEMIN1 antibody, SMA antibody, SMA1 antibody, SMA2 antibody, SMA3 antibody, SMA4 antibody, SMA@ antibody, SMNT antibody, T-BCD541 antibody, TDRD16A antibody, AI849087 antibody, Gemin1 antibody, SMN1 antibody, QtsA-10002 antibody, fa12d01 antibody, smn antibody, wu:fa12d01 antibody, survival motor neuron protein antibody, survival of motor neuron 1, telomeric antibody, survival motor neuron 1 antibody, survival of motor neuron 2, centromeric antibody, survival motor neuron protein-like antibody, survival motor neuron antibody, LOC461829 antibody, Smn1 antibody, SMN1 antibody, SMN2 antibody, LOC100348318 antibody, SMN antibody, LOC100713418 antibody, LOC100065744 antibody, LOC102176643 antibody, smn1 antibody

Background: Name/Gene ID: SMN1

Synonyms: SMN1, BCD541, Component of gems 1, Gemin-1, SMA2, SMA4, SMA@, SMA1, SMNC, SMNT, T-BCD541, SMN, Survival motor neuron protein, Gemin 1, GEMIN1, SMA, SMA3

Gene ID: 6606

Pathways: Ribonucleoprotein Complex Subunit Organization