ATP2A1/SERCA1 antibody (N-Term)

Catalog No. ABIN3030066

Product Details anti-ATP2A1/SERCA1 Antibody

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A1/SERCA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ATP2A1/SERCA1

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Alternative Name: ATP2A1 (ATP2A1 Products)

Synonyms: cb279 antibody, serca antibody, serca1 antibody, wu:cegs655 antibody, wu:fb17h11 antibody, wu:fb19b10 antibody, zgc:92110 antibody, ATP2A1 antibody, atp2a antibody, atp2a2 antibody, atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, SERCA1 antibody, ATP2A3 antibody, SERCA1a antibody, Serca1 antibody, ATP2A antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog antibody, atp2a1 antibody, ATP2A1 antibody, atp2a2.S antibody, Atp2a1 antibody

Background: SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

Gene ID: 487

Pathways: Ribonucleoside Biosynthetic Process