RUNX1 antibody (Middle Region)

Catalog No. ABIN3032499

Product Details anti-RUNX1 Antibody

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat).

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the RUNX1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the RUNX1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for RUNX1

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Alternative Name: RUNX1 (AML1) (RUNX1 Products)

Synonyms: RUNX1 antibody, runx1 antibody, AI462102 antibody, AML1 antibody, Cbfa2 antibody, Pebp2a2 antibody, Pebpa2b antibody, AML1-EVI-1 antibody, AMLCR1 antibody, CBFA2 antibody, EVI-1 antibody, PEBP2aB antibody, runxa antibody, Runx-1 antibody, XAML antibody, Xaml1 antibody, aml antibody, aml-1 antibody, aml1 antibody, aml1-evi-1 antibody, amlcr1 antibody, cbfa2 antibody, evi-1 antibody, pebp2ab antibody, Aml1 antibody, uncharacterized LOC473981 antibody, runt-related transcription factor antibody, runt related transcription factor 1 antibody, runt-related transcription factor 1 antibody, runt related transcription factor 1 L homeolog antibody, LOC473981 antibody, runt antibody, Runx1 antibody, RUNX1 antibody, runx1 antibody, runx1.L antibody

Background: Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa). RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer.

Gene ID: 861