FMR1 antibody (N-Term)

Catalog No. ABIN3042398

Product Details anti-FMR1 Antibody

Target: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Binding Specificity: AA 164-200, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: ENYQLVILSI NEVTSKRAHM LIDMHFRSLR TKLSLIM

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: fragile X mental retardation 1
Protein Name: Synaptic functional regulator FMR1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FMR1

Target: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Alternative Name: FMR1 (FMR1 Products)

Synonyms: AT24755 antibody, BcDNA:GM08679 antibody, CG6203 antibody, Dmel\\CG6203 antibody, EP(3)3517 antibody, FMR antibody, FMR1 antibody, FMRP antibody, FMRp antibody, FXR antibody, Fmrp antibody, cg6203 antibody, dFMR antibody, dFMR1 antibody, dFMRP antibody, dFXR antibody, dFXR1 antibody, dFXRP antibody, dFmr1 antibody, dFmrp antibody, dfmr antibody, dfmr1 antibody, dfxr antibody, dfxr1 antibody, dmfr1 antibody, fmr antibody, fmr1 antibody, FRAXA antibody, POF antibody, POF1 antibody, zFMR1 antibody, Fmr-1 antibody, CG6203 gene product from transcript CG6203-RC antibody, fragile X mental retardation 1 antibody, fragile X mental retardation syndrome 1 antibody, Fmr1 antibody, FMR1 antibody, fmr1 antibody

Background: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mentalretardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

Synonyms: FMR 1 antibody|Fmr1 antibody|Fmr1 gene antibody|FMR1_HUMAN antibody|FMRP antibody|Fragile X mental retardation 1 antibody|Fragile X mental retardation 1 protein antibody|Fragile X mental retardation protein 1 antibody|FRAXA antibody|MGC87458 antibody|POF antibody| POF1 antibody|Protein FMR-1 antibody|Protein FMR1 antibody

Gene ID: 2332

UniProt: Q06787

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development