TGFBR1 antibody (N-Term)
-
- Target See all TGFBR1 Antibodies
- TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
-
Binding Specificity
- AA 149-186, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TGFBR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.
- Sequence
- HNRTVIHHRV PNEEDPSLDR PFISEGTTLK DLIYDMTT
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.
Gene Name: transforming growth factor, beta receptor 1
Protein Name: TGF-beta receptor type-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product TGFBR1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." in: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).
: "[Effect of interferon-α on rat liver fibrosis induced by CCl(4)]." in: Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences, Vol. 36, Issue 3, pp. 243-8, (2012) (PubMed).
: "The expression of AT1 receptor on hepatic stellate cells in rat fibrosis induced by CCl4." in: Chinese medical journal, Vol. 114, Issue 6, pp. 583-7, (2002) (PubMed).
: "
-
Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." in: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).
-
- Target
- TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
- Alternative Name
- TGFBR1 (TGFBR1 Products)
- Synonyms
- AAT5 antibody, ACVRLK4 antibody, ALK-5 antibody, ALK5 antibody, LDS1A antibody, LDS2A antibody, MSSE antibody, SKR4 antibody, TGFR-1 antibody, aat5 antibody, acvrlk4 antibody, alk-5 antibody, alk5 antibody, lds1a antibody, lds2a antibody, skr4 antibody, tgfr-1 antibody, TGFBR1 antibody, x-trr1 antibody, AU017191 antibody, Alk-5 antibody, TbetaR-I antibody, TbetaRI antibody, Alk5 antibody, Skr4 antibody, Tgfr-1 antibody, tbetaR-I antibody, tgfbr1 antibody, zgc:123263 antibody, transforming growth factor beta receptor 1 antibody, transforming growth factor beta receptor I antibody, transforming growth factor beta receptor I S homeolog antibody, transforming growth factor, beta receptor I antibody, transforming growth factor, beta receptor 1 antibody, transforming growth factor, beta receptor 1 a antibody, TGFBR1 antibody, tgfbr1 antibody, tgfbr1.S antibody, Tgfbr1 antibody, tgfbr1a antibody
- Background
-
Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.
Synonyms: AAT 5 antibody|AAT5 antibody|Activin A receptor type II like kinase 53 kDa antibody|Activin A receptor type II like kinase, 53kD antibody|Activin A receptor type II like protein kinase of 53kD antibody|activin A receptor type II-like kinase, 53 kDa antibody| activin A receptor type II-like protein kinase of 53kD antibody|Activin receptor like kinase 5 antibody|Activin receptor-like kinase 5 antibody|ACVRLK 4 antibody|ACVRLK4 antibody|ALK 5 antibody|ALK-5 antibody|ALK5 antibody|LDS1A antibody|LDS2A antibody|MSSE antibody| Serine/threonine protein kinase receptor R4 antibody|Serine/threonine-protein kinase receptor R4 antibody|SKR 4 antibody|SKR4 antibody|TbetaR I antibody|TbetaR-I antibody|TGF beta receptor type 1 antibody|TGF beta receptor type I antibody|TGF beta type I receptor antibody|TGF-beta receptor type I antibody|TGF-beta receptor type-1 antibody|TGF-beta type I receptor antibody|TGFBR 1 antibody|TGFBR1 antibody|TGFBR1 protein antibody|TGFR 1 antibody|TGFR-1 antibody|TGFR1 antibody|TGFR1_HUMAN antibody|Transforming growth factor beta receptor 1 antibody|Transforming growth factor beta receptor I (activin A receptor type II like kinase, 53kD) antibody|Transforming growth factor beta receptor I antibody|transforming growth factor, beta receptor 1 antibody|transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD) antibody|Transforming growth factor-beta receptor type I antibody - Gene ID
- 7046
- UniProt
- P36897
- Pathways
- Growth Factor Binding
-