CD19 antibody (Middle Region)

Catalog No. ABIN3043389

Product Details anti-CD19 Antibody

Target: CD19 (CD19 Molecule (CD19))

Binding Specificity: AA 307-337, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD19 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.

Sequence: LVGILHLQRA LVLRRKRKRM TDPTRRFFKV T

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.
Gene Name: CD19 Molecule
Protein Name: B-lymphocyte antigen CD19

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CD19

Target: CD19 (CD19 Molecule (CD19))

Alternative Name: CD19 (CD19 Products)

Synonyms: B4 antibody, CVID3 antibody, AW495831 antibody, CD19 antibody, CD19 molecule antibody, CD19 antigen antibody, CD19 antibody, Cd19 antibody

Background: B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.

Synonyms: Antibody deficiency due to defect in CD19, included antibody|AW495831 antibody|B lymphocyte antigen CD19 antibody|B lymphocyte surface antigen B4 antibody|B-lymphocyte antigen CD19 antibody|B-lymphocyte surface antigen B4 antibody|B4 antibody|CD19 antibody|CD19 antigen antibody|CD19 Molecule antibody|Cd19 protein antibody|CD19_HUMAN antibody|CVID3 antibody|Differentiation antigen CD19 antibody|Leu 12 antibody|Leu-12 antibody|Leu12 antibody|MGC109570 antibody|MGC12802 antibody|T-cell surface antigen Leu-12 antibody

Gene ID: 930

UniProt: P15391

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway