NME1 antibody (N-Term)

Catalog No. ABIN3043572

Product Details anti-NME1 Antibody

Target: NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in (NME1))

Binding Specificity: AA 26-58, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NME1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: KRFEQKGFRL VGLKFMQASE DLLKEHYVDL KDR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: NME/NM23 nucleoside diphosphate kinase 1
Protein Name: Nucleoside diphosphate kinase A

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-NME1 antibody (ABIN3043572)

Jin, Dai: "Mutation of the nm23-H1 gene has a non-dominant role in colorectal adenocarcinoma." in: Molecular and clinical oncology, Vol. 5, Issue 1, pp. 107-110, (2016) (PubMed).

Target Details for NME1

Target: NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in (NME1))

Alternative Name: NME1 (NME1 Products)

Synonyms: AWD antibody, GAAD antibody, NB antibody, NBS antibody, NDKA antibody, NDPK-A antibody, NDPKA antibody, NM23 antibody, NM23-H1 antibody, AL024257 antibody, NM23-M1 antibody, NM23A antibody, NDPK-Z1 antibody, NM23-B antibody, NM23-Z1 antibody, ndpkz1 antibody, nm23b antibody, nme1 antibody, nme2 antibody, nme2b1 antibody, NME1 antibody, NME1-NME2 antibody, NM23-C1 antibody, ndpk-b antibody, ndpkb antibody, nm23-h2 antibody, nm23ndk antibody, puf antibody, NBR-A antibody, NBR-B antibody, NME1-1 antibody, nm23ndk-a antibody, NDK I antibody, NDPK I antibody, T30A10.80 antibody, T30A10_80 antibody, NDP kinase I antibody, NME/NM23 nucleoside diphosphate kinase 1 antibody, NME/NM23 nucleoside diphosphate kinase 2b, tandem duplicate 1 antibody, non-metastatic cells 1, protein (NM23A) expressed in antibody, NME/NM23 nucleoside diphosphate kinase 2 S homeolog antibody, NME/NM23 nucleoside diphosphate kinase 2 L homeolog antibody, nucleoside diphosphate kinase antibody, nucleoside diphosphate kinase 1 antibody, NME1 antibody, Nme1 antibody, nme2b.1 antibody, nme2.S antibody, nme2.L antibody, LOC547870 antibody, NDPK1 antibody, LOC107790563 antibody

Background: NME1(NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.

Synonyms: AWD antibody|AWD, drosophila, homolog of antibody|GAAD antibody|Granzyme A activated DNase antibody|Granzyme A-activated DNase antibody|GZMA activated DNase antibody|Metastasis inhibition factor NM23 antibody|NB antibody|NBS antibody|NDK A antibody|NDKA antibody|NDKA_HUMAN antibody|NDP kinase A antibody|NDPK-A antibody|NDPKA antibody|NM23 antibody|NM23 long variant, included antibody|nm23-H1 antibody|NM23-M1 antibody|NM23H1B, included antibody|NME/NM23 nucleoside diphosphate kinase 1 antibody|Nme1 antibody|NME1-NME2 spliced read-through transcript, included antibody|Non-metastatic cells 1, protein (NM23A) expressed in antibody| Nonmetastatic cells 1, protein expressed in antibody|Nonmetastatic protein 23 antibody|Nonmetastatic protein 23, homolog 1 antibody| Nucleoside diphosphate kinase A antibody|Tumor metastatic process-associated protein antibody

Gene ID: 4830

UniProt: P15531

Pathways: Apoptosis, Nucleotide Phosphorylation, Carbohydrate Homeostasis, Ribonucleoside Biosynthetic Process