NQO1 antibody (C-Term)
-
- Target See all NQO1 Antibodies
- NQO1 (NAD(P)H Dehydrogenase, Quinone 1 (NQO1))
-
Binding Specificity
- AA 242-274, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NQO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
- Sequence
- EVQDEEKNKK FGLSVGHHLG KSIPTDNQIK ARK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
Gene Name: NAD(P)H dehydrogenase, quinone 1
Protein Name: NAD(P)H dehydrogenase [quinone] 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product NQO1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- NQO1 (NAD(P)H Dehydrogenase, Quinone 1 (NQO1))
- Alternative Name
- NQO1 (NQO1 Products)
- Synonyms
- zgc:77191 antibody, wu:fb63c10 antibody, nqo1 antibody, DHQU antibody, DIA4 antibody, DTD antibody, NMOR1 antibody, NMORI antibody, QR1 antibody, Dia4 antibody, AV001255 antibody, Dtd antibody, Nmo-1 antibody, Nmo1 antibody, Nmor1 antibody, Ox-1 antibody, Ox1 antibody, Qr1 antibody, NADPH-d antibody, NAD(P)H dehydrogenase, quinone 1 antibody, NAD(P)H quinone dehydrogenase 1 antibody, NAD(P)H dehydrogenase, quinone 1 L homeolog antibody, nqo1 antibody, NQO1 antibody, Bpet2092 antibody, nqo1.L antibody, Nqo1 antibody
- Background
-
This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms: Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody|DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody|NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody|NAD(P)H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody|NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody - Gene ID
- 1728
- UniProt
- P15559
-