Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PDIA3 antibody (C-Term)

PDIA3 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043898
  • Target See all PDIA3 Antibodies
    PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))
    Binding Specificity
    • 16
    • 15
    • 9
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 471-505, C-Term
    Reactivity
    • 83
    • 37
    • 34
    • 8
    • 8
    • 7
    • 6
    • 6
    • 6
    • 6
    • 5
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 68
    • 27
    • 3
    Rabbit
    Clonality
    • 65
    • 33
    Polyclonal
    Conjugate
    • 40
    • 7
    • 7
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This PDIA3 antibody is un-conjugated
    Application
    • 75
    • 31
    • 28
    • 27
    • 16
    • 16
    • 15
    • 13
    • 13
    • 8
    • 4
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    RELSDFISYL QREATNPPVI QEEKPKKKKK AQEDL
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: protein disulfide isomerase family A, member 3
    Protein Name: Protein disulfide-isomerase A3
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product PDIA3 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Shen, Chen, Yang, Chen, Liu, Ni: "Redox proteomics identification of specifically carbonylated proteins in the hippocampi of triple transgenic Alzheimer's disease mice at its earliest pathological stage." in: Journal of proteomics, Vol. 123, pp. 101-13, (2015) (PubMed).

  • Target
    PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))
    Alternative Name
    PDIA3 (PDIA3 Products)
    Synonyms
    ER60 antibody, ERp57 antibody, ERp60 antibody, ERp61 antibody, GRP57 antibody, GRP58 antibody, HsT17083 antibody, P58 antibody, PI-PLC antibody, grp-58 antibody, 58kDa antibody, Erp antibody, Grp58 antibody, PDI antibody, PDI-Q2 antibody, PLC[a] antibody, Plca antibody, 1 antibody, 25D3-membrane-associated antibody, sb:cb825 antibody, erp57 antibody, grp58 antibody, pdia3 antibody, protein disulfide isomerase family A member 3 antibody, protein disulfide-isomerase A3 antibody, protein disulfide isomerase associated 3 antibody, protein disulfide isomerase family A, member 3 antibody, protein disulfide isomerase family A member 3 S homeolog antibody, PDIA3 antibody, Tsp_10062 antibody, Pdia3 antibody, pdia3 antibody, pdia3.S antibody
    Background
    PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.

    Synonyms: 58 kDa glucose regulated protein antibody|58 kDa glucose-regulated protein antibody|58 kDa microsomal protein antibody|Disulfide isomerase ER 60 antibody|Disulfide isomerase ER-60 antibody|Endoplasmic reticulum resident protein 57 antibody|Endoplasmic reticulum resident protein 60 antibody|ER p57 antibody|ER protein 57 antibody|ER protein 60 antibody|ERp 57 antibody|ERp57 antibody|ERp60 antibody|ERp61 antibody|Glucose Regulated Protein 58 Kd antibody|GRP 57 antibody|GRP 58 antibody|GRP57 antibody|GRP58 antibody| HsT17083 antibody|P58 antibody|PDIA 3 antibody|PDIA3 antibody|PDIA3_HUMAN antibody|Phospholipase C alpha antibody|PI PLC antibody| Protein disulfide isomerase A3 antibody|Protein disulfide isomerase family A member 3 antibody|Protein disulfide-isomerase A3 antibody
    Gene ID
    2923
    UniProt
    P30101
    Pathways
    Maintenance of Protein Location, Protein targeting to Nucleus, Cell RedoxHomeostasis
You are here:
Support