AP2M1 antibody (C-Term)

Catalog No. ABIN4886462

Product Details anti-AP2M1 Antibody

Target: AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))

Binding Specificity: AA 399-435, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AP2M1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: LKVRYLKVFE PKLNYSDHDV IKWVRYIGRS GIYETRC

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adaptor related protein complex 2 mu 1 subunit
Protein Name: AP-2 complex subunit mu

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for AP2M1

Target: AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))

Alternative Name: AP2M1 (AP2M1 Products)

Synonyms: AP50 antibody, CLAPM1 antibody, mu2 antibody, Ap50 antibody, Clapm1 antibody, cb34 antibody, Ap2m1 antibody, dpy-23 antibody, sb:cb34 antibody, zgc:55711 antibody, zgc:85653 antibody, wu:fa97a10 antibody, ap2m1-a antibody, ap2m1 antibody, zgc:56643 antibody, AP2M1 antibody, adaptor related protein complex 2 mu 1 subunit antibody, adaptor-related protein complex 2, mu 1 subunit antibody, adaptor-related protein complex 2, mu 1 subunit, a antibody, adaptor related protein complex 2 mu 1 subunit L homeolog antibody, adaptor-related protein complex 2, mu 1 subunit, b antibody, AP-2 complex subunit mu-1 antibody, clathrin coat assembly protein AP50 antibody, clathrin coat assembly protein ap50 antibody, AP2M1 antibody, Ap2m1 antibody, ap2m1a antibody, ap2m1.L antibody, ap2m1b antibody, ap2m1 antibody, cgd8_950 antibody, PY06523 antibody, PVX_118455 antibody, PVX_123590 antibody, CpipJ_CPIJ003697 antibody

Background: AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.

Synonyms: Adaptin mu 1 | Adaptin-mu2 | AP 2 mu 2 chain | AP-2 complex subunit mu | Ap2m1 | AP50 | CLAPM1 | Q96CW1

Gene ID: 1173

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation, SARS-CoV-2 Protein Interactome