CYP3A4 antibody (Middle Region)
-
- Target See all CYP3A4 Antibodies
- CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))
-
Binding Specificity
- AA 237-277, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP3A4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.
- Sequence
- NICVFPREVT NFLRKSVKRM KESRLEDTQK HRVDFLQLMI D
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.
Gene Name: cytochrome P450 family 3 subfamily A member 4
Protein Name: Cytochrome P450 3A4 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID).
- Isotype
- IgG
- Top Product
- Discover our top product CYP3A4 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))
- Alternative Name
- CYP3A4 (CYP3A4 Products)
- Synonyms
- CP33 antibody, CP34 antibody, CYP3A antibody, CYP3A3 antibody, CYPIIIA3 antibody, CYPIIIA4 antibody, HLP antibody, NF-25 antibody, P450C3 antibody, P450PCN1 antibody, MGC108372 antibody, CYP3A80 antibody, CYP3A4 antibody, CYP3A21 antibody, CYPIIIA21 antibody, CYP3A12 antibody, cytochrome P450 family 3 subfamily A member 4 antibody, cytochrome P450 family 3 subfamily A member 43 antibody, cytochrome P450 3A4 antibody, cytochrome P450, subfamily IIIA, polypeptide 4 antibody, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antibody, cytochrome P450, family 3, subfamily A, polypeptide 4 antibody, CYP3A4 antibody, CYP3A43 antibody, PTRG_01782 antibody, PTRG_06060 antibody, cyp3a4 antibody
- Background
-
Cytochrome P450 3A4 (abbreviated CYP3A4), is an important enzyme in the body, mainly found in the liver and in the intestine. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist, however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: CP33 | CP34 | CYP3 | CYP3A | CYP3A3 | CYP3A4 | CYPIIIA3 | CYPIIIA4 | HLP | NF 25 | NF25 | Nifedipine oxidase | P450 PCN1 | P450C3 | P450PCN1 | P08684 - Gene ID
- 1576
- UniProt
- P08684
- Pathways
- Steroid Hormone Biosynthesis
-