TGFBR1 antibody (N-Term)

Catalog No. ABIN4886739

Product Details anti-TGFBR1 Antibody

Target: TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))

Binding Specificity: AA 149-186, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGFBR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: HNRTVIHHRV PNEEDPSLDR PFISEGTTLK DLIYDMTT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: transforming growth factor, beta receptor 1
Protein Name: TGF-beta receptor type-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-TGFBR1 antibody (ABIN4886739)

Wang, Qin, Deng, Yao: "Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." in: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).

Li, Yang: "[Effect of interferon-α on rat liver fibrosis induced by CCl(4)]." in: Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences, Vol. 36, Issue 3, pp. 243-8, (2012) (PubMed).

Wei, Lu, Li, Zhan, Wang, Huang: "The expression of AT1 receptor on hepatic stellate cells in rat fibrosis induced by CCl4." in: Chinese medical journal, Vol. 114, Issue 6, pp. 583-7, (2002) (PubMed).

Target Details for TGFBR1

Target: TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))

Alternative Name: TGFBR1 (TGFBR1 Products)

Synonyms: AAT5 antibody, ACVRLK4 antibody, ALK-5 antibody, ALK5 antibody, LDS1A antibody, LDS2A antibody, MSSE antibody, SKR4 antibody, TGFR-1 antibody, aat5 antibody, acvrlk4 antibody, alk-5 antibody, alk5 antibody, lds1a antibody, lds2a antibody, skr4 antibody, tgfr-1 antibody, TGFBR1 antibody, x-trr1 antibody, AU017191 antibody, Alk-5 antibody, TbetaR-I antibody, TbetaRI antibody, Alk5 antibody, Skr4 antibody, Tgfr-1 antibody, tbetaR-I antibody, tgfbr1 antibody, zgc:123263 antibody, transforming growth factor beta receptor 1 antibody, transforming growth factor beta receptor I antibody, transforming growth factor beta receptor I S homeolog antibody, transforming growth factor, beta receptor I antibody, transforming growth factor, beta receptor 1 antibody, transforming growth factor, beta receptor 1 a antibody, TGFBR1 antibody, tgfbr1 antibody, tgfbr1.S antibody, Tgfbr1 antibody, tgfbr1a antibody

Background: Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.

Synonyms: AAT5 | ALK 5 | ALK5 | ALK-5 | MSSE | SKR 4 | SKR4 | TbetaR I | TbetaR-I | tgf b receptor i | TGF beta Receptor I | TGF beta receptor type 1 | TGF beta receptor type I | TGF beta type I receptor | TGF-beta receptor type I | TGF-beta receptor type-1 | TGF-beta type I receptor | TGFBR 1 | TGFBR1 protein | TGFR 1 | TGFR1 | TGFR-1 | P36897

Gene ID: 7046

UniProt: P36897

Pathways: Growth Factor Binding