YAP1 antibody (N-Term)

Catalog No. ABIN4886772

Product Details anti-YAP1 Antibody

Target: YAP1 (Yes-Associated Protein 1 (YAP1))

Binding Specificity: AA 62-97, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1(YAP1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: ETDLEALFNA VMNPKTANVP QTVPMRLRKL PDSFFK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1(YAP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Yes associated protein 1
Protein Name: Transcriptional coactivator YAP1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for YAP1

Target: YAP1 (Yes-Associated Protein 1 (YAP1))

Alternative Name: YAP1 (YAP1 Products)

Synonyms: YAP antibody, YAP2 antibody, YAP65 antibody, YKI antibody, xyap antibody, yap antibody, yap2 antibody, yap65 antibody, yki antibody, AI325207 antibody, Yap antibody, Yap65 antibody, Yki antibody, Yorkie antibody, cb194 antibody, sb:cb194 antibody, si:ch211-181p1.5 antibody, si:dkey-3b8.3 antibody, wu:fc18c04 antibody, zgc:158380 antibody, Yes associated protein 1 antibody, Yes associated protein 1 S homeolog antibody, yes-associated protein 1 antibody, Yes-associated protein 1 antibody, YAP1 antibody, yap1.S antibody, Yap1 antibody, yap1 antibody

Background: YAP1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Synonyms: YAp 1 | YAp1 | YAP2 | YAP 65 | YAP65 | YKI | Yorkie homolog | P46937

Gene ID: 10413

UniProt: P46937

Pathways: MAPK Signaling, Stem Cell Maintenance, Regulation of Lipid Metabolism by PPARalpha