ARID1A antibody

Catalog No. ABIN4950208

Product Details anti-ARID1A Antibody

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARID1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ARID1A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ARID1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ARID1A

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Alternative Name: ARID1A (ARID1A Products)

Synonyms: B120 antibody, BAF250 antibody, BAF250a antibody, BM029 antibody, C1orf4 antibody, ELD antibody, MRD14 antibody, OSA1 antibody, P270 antibody, SMARCF1 antibody, hELD antibody, hOSA1 antibody, 1110030E03Rik antibody, Osa1 antibody, Smarcf1 antibody, ARID1A antibody, wu:fb79b07 antibody, wu:fb95g08 antibody, zgc:171438 antibody, AT-rich interaction domain 1A antibody, AT rich interactive domain 1A (SWI-like) antibody, AT rich interactive domain 1Aa (SWI-like) antibody, ARID1A antibody, Arid1a antibody, arid1a antibody, arid1aa antibody

Background: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

UniProt: O14497

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Tube Formation