CYP27B1 antibody

Catalog No. ABIN4950731

Product Details anti-CYP27B1 Antibody

Target: CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP27B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR of human CYP27B1 were used as the immunogen for the CYP27B1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CYP27B1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CYP27B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CYP27B1

Target: CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))

Alternative Name: CYP27B1 (CYP27B1 Products)

Synonyms: cp2b antibody, cyp1 antibody, cyp1alpha antibody, cyp27b antibody, p450c1 antibody, pddr antibody, vdd1 antibody, vddr antibody, vddri antibody, vdr antibody, CP2B antibody, CYP1 antibody, CYP1alpha antibody, CYP27B antibody, P450c1 antibody, PDDR antibody, VDD1 antibody, VDDR antibody, VDDRI antibody, VDR antibody, Cyp40 antibody, Cp2b antibody, Cyp1 antibody, Cyp27b antibody, Pddr antibody, Vdd1 antibody, Vddr antibody, VddrI antibody, Vdr antibody, cytochrome P450 family 27 subfamily B member 1 antibody, cytochrome P450, family 27, subfamily B, polypeptide 1 antibody, cytochrome P450, family 27, subfamily b, polypeptide 1 antibody, cyp27b1 antibody, CYP27B1 antibody, Cyp27b1 antibody

Background: CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.

UniProt: O15528

Pathways: Metabolism of Steroid Hormones and Vitamin D