GADD45A antibody

Catalog No. ABIN4951127

Product Details anti-GADD45A Antibody

Target: GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GADD45A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the GADD45A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the GADD45A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for GADD45A

Target: GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))

Alternative Name: GADD45A (GADD45A Products)

Synonyms: MGC53491 antibody, zgc:91795 antibody, gadd45a antibody, GADD45A antibody, ddit1 antibody, gadd45 antibody, GADD45 antibody, AA545191 antibody, Ddit1 antibody, DDIT1 antibody, Gadd45 antibody, growth arrest and DNA damage inducible alpha L homeolog antibody, growth arrest and DNA-damage-inducible, alpha, b antibody, growth arrest and DNA damage inducible alpha antibody, growth arrest and DNA damage-inducible protein 45 antibody, growth arrest and DNA-damage-inducible 45 alpha antibody, growth arrest and DNA-damage-inducible, alpha antibody, gadd45a.L antibody, gadd45ab antibody, GADD45A antibody, gadd45a antibody, GADD45 antibody, Gadd45a antibody

Background: Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.

UniProt: P24522

Pathways: p53 Signaling, Cell Division Cycle