GNAQ antibody

Catalog No. ABIN4951194

Product Details anti-GNAQ Antibody

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAQ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the GNAQ antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the GNAQ antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for GNAQ

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Alternative Name: GNAQ (GNAQ Products)

Synonyms: si:ch73-270f14.2 antibody, CMC1 antibody, G-ALPHA-q antibody, GAQ antibody, SWS antibody, Galphaq antibody, Gnaq antibody, g-alpha-q antibody, gaq antibody, gnaqb antibody, 1110005L02Rik antibody, 6230401I02Rik antibody, AA408290 antibody, AW060788 antibody, Dsk1 antibody, Dsk10 antibody, Gq antibody, GqI antibody, guanine nucleotide binding protein (G protein), q polypeptide antibody, G protein subunit alpha q antibody, guanine nucleotide binding protein (G protein), q polypeptide S homeolog antibody, guanine nucleotide binding protein, alpha q polypeptide antibody, gnaq antibody, GNAQ antibody, Gnaq antibody, gnaq.S antibody

Background: Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

UniProt: P50148

Pathways: JAK-STAT Signaling, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction