Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GRP78 antibody

HSPA5 Reactivity: Human, Rat, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4951256
  • Target See all GRP78 (HSPA5) Antibodies
    GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
    Reactivity
    • 181
    • 121
    • 103
    • 38
    • 38
    • 36
    • 34
    • 32
    • 31
    • 20
    • 15
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Rat, Mouse
    Host
    • 127
    • 89
    • 8
    • 3
    • 1
    • 1
    Rabbit
    Clonality
    • 132
    • 98
    Polyclonal
    Conjugate
    • 95
    • 21
    • 17
    • 14
    • 13
    • 12
    • 9
    • 8
    • 8
    • 8
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This GRP78 antibody is un-conjugated
    Application
    • 215
    • 103
    • 86
    • 85
    • 75
    • 34
    • 31
    • 28
    • 26
    • 19
    • 13
    • 7
    • 6
    • 3
    • 3
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity
    Immunogen
    Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product HSPA5 Primary Antibody
  • Application Notes
    Optimal dilution of the GRP78 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the GRP78 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
    Alternative Name
    GRP78 / BiP (HSPA5 Products)
    Synonyms
    GRP78 antibody, BiP antibody, GRP-78 antibody, grp78 antibody, hspa5a antibody, BIP antibody, MIF2 antibody, AL022860 antibody, AU019543 antibody, Bip antibody, D2Wsu141e antibody, D2Wsu17e antibody, Grp78 antibody, Hsce70 antibody, SEZ-7 antibody, Sez7 antibody, baffled antibody, mBiP antibody, cb865 antibody, fb60h09 antibody, fi36d04 antibody, wu:fb60h09 antibody, wu:fi36d04 antibody, zgc:55994 antibody, zgc:77606 antibody, 78 kDa glucose-regulated protein antibody, heat shock protein family A (Hsp70) member 5 antibody, BiP/GRP78 antibody, glucose-regulated protein 78 antibody, putative glucose-regulated protein 78 antibody, Hsp70 family ATPase KAR2 antibody, heat shock protein family A (Hsp70) member 5 S homeolog antibody, heat shock 70 kDa protein 5a antibody, heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) antibody, heat shock protein 5 antibody, heat shock protein family A member 5 antibody, CpipJ_CPIJ003550 antibody, HSPA5 antibody, grp78 antibody, LOC100533358 antibody, BiP/grp78 antibody, Tc00.1047053506585.40 antibody, Tb11.02.5450 antibody, Tb11.02.5500 antibody, LMJF_28_1200 antibody, KAR2 antibody, LOC100135840 antibody, hspa5.S antibody, hspa5 antibody, Hspa5 antibody
    Background
    HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.
    UniProt
    P11021
    Pathways
    Thyroid Hormone Synthesis, ER-Nucleus Signaling
You are here:
Support