HSD11B2 antibody

Catalog No. ABIN4951362

Product Details anti-HSD11B2 Antibody

Target: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD11B2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH of human HSD11B2 were used as the immunogen for the HSD11B2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HSD11B2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HSD11B2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HSD11B2

Target: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Alternative Name: HSD11B2 (HSD11B2 Products)

Synonyms: MGC81883 antibody, 11-HSD2 antibody, AME antibody, AME1 antibody, HSD11K antibody, HSD2 antibody, SDR9C3 antibody, 11HSD2 antibody, HSD11B2 antibody, hydroxysteroid (11-beta) dehydrogenase 2 L homeolog antibody, hydroxysteroid 11-beta dehydrogenase 2 antibody, hsd11b2.L antibody, HSD11B2 antibody, Hsd11b2 antibody

Background: Corticosteroid 11-β,-dehydrogenase isozyme 2, also known as 11-β,-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

UniProt: P80365

Pathways: Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones