ICA1 antibody

Catalog No. ABIN4951392

Product Details anti-ICA1 Antibody

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ICA1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Alternative Name: ICA1 (ICA1 Products)

Synonyms: ica1 antibody, MGC52730 antibody, ICA1 antibody, DKFZp469G0321 antibody, zgc:92566 antibody, 69kDa antibody, ICA69 antibody, Ica69 antibody, MGC83241 antibody, ICAp69 antibody, islet cell autoantigen 1 L homeolog antibody, islet cell autoantigen 1 antibody, Islet cell autoantigen 1 antibody, islet cell autoantigen 1 S homeolog antibody, ica1.L antibody, ICA1 antibody, ica1 antibody, ica69 antibody, Ica1 antibody, ica1.S antibody

Background: Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

UniProt: Q05084