IDH1 antibody

Catalog No. ABIN4951400

Product Details anti-IDH1 Antibody

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDH1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogen: Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK of human IDH1 were used as the immunogen for the IDH1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IDH1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IDH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IDH1

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Alternative Name: IDH1 (IDH1 Products)

Synonyms: IDCD antibody, IDH antibody, IDP antibody, IDPC antibody, PICD antibody, NADP-CICDH antibody, AI314845 antibody, AI788952 antibody, E030024J03Rik antibody, Id-1 antibody, Idh-1 antibody, Idpc antibody, cb876 antibody, fm90e09 antibody, im:7143416 antibody, wu:fm90e09 antibody, F23E12.180 antibody, F23E12_180 antibody, IDH-I antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antibody, isocitrate dehydrogenase 1 antibody, isocitrate dehydrogenase I antibody, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antibody, isocitrate dehydrogenase 1 (NADP+), soluble antibody, isocitrate dehydrogenase 1 (NADP+) L homeolog antibody, isocitrate dehydrogenase 1 antibody, IDH1 antibody, Idh1 antibody, idh1.L antibody, idh1 antibody

Background: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

UniProt: O75874

Pathways: Warburg Effect