KCNA2 antibody

Catalog No. ABIN4951574

Product Details anti-KCNA2 Antibody

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNA2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Kv1.2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Kv1.2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KCNA2

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Alternative Name: Kv1.2 (KCNA2 Products)

Synonyms: KCNA2 antibody, kcna2 antibody, HBK5 antibody, HK4 antibody, HUKIV antibody, KV1.2 antibody, MK2 antibody, NGK1 antibody, RBK2 antibody, Akr6a4 antibody, ENSMUSG00000074335 antibody, Gm10672 antibody, Kca1-2 antibody, Kv1.2 antibody, Mk-2 antibody, BK2 antibody, XSha2 antibody, k(v)1.2 antibody, kcna2-a antibody, kv1.2 antibody, potassium voltage-gated channel subfamily A member 2 antibody, potassium channel, voltage gated shaker related subfamily A, member 1 antibody, potassium voltage-gated channel, shaker-related subfamily, member 2 antibody, potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog antibody, KCNA2 antibody, kcna1 antibody, Kcna2 antibody, LOC100537815 antibody, kcna2.S antibody

Background: Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

UniProt: P16389